Home   Guide to ATMT Database   Sitemap   Contact  
Sequence ID  5330076
Locus Name  MGG_09281.5
Gene Name  
Protein Name  hypothetical protein
Species Name  Magnaporthe grisea [Magnaporthe oryzae 5 PROTEINS]
Protein Sequence
[66 aa]
+ 1

MPATTAPAQTANAADANKPKPCCVCKDEKAARDECMLFSNAKDPAEDCKTKIEQYKSCMAGFGFKV

DNA Sequence
[201 bp]
+  1
101
201
ATGCCTGCAACCACCGCGCCGGCGCAAACCGCCAATGCAGCCGACGCCAACAAGCCCAAGCCCTGCTGTGTTTGCAAAGATGAAAAGGCAGCTCGCGACGAGTGCATGCTTTTCTCCAACGCCAAGGACCCAGCCGAGGATTGCAAGACAAAGATAGAACAGTACAAGAGCTGCATGGCGGGCTTTGGATTCAAGGTCTGA
AGTGCATGCTTTTCTCCAACGCCAAGGACCCAGCCGAGGATTGCAAGACAAAGATAGAACAGTACAAGAGCTGCATGGCGGGCTTTGGATTCAAGGTCTG
Position in Contig 592513 ~ 592873 (361 bp, 160 bp) in Magnaporthe grisea 70-15 supercontig 5.186 (Strand +) (Frame : 1)
Chromosome Chromosome : Not defined!
Contig Sequence
(582501 ~ 602800)

+582501
582601
582701
582801
582901
583001
583101
583201
583301
583401
583501
583601
583701
583801
583901
584001
584101
584201
584301
584401
584501
584601
584701
584801
584901
585001
585101
585201
585301
585401
585501
585601
585701
585801
585901
586001
586101
586201
586301
586401
586501
586601
586701
586801
586901
587001
587101
587201
587301
587401
587501
587601
587701
587801
587901
588001
588101
588201
588301
588401
588501
588601
588701
588801
588901
589001
589101
589201
589301
589401
589501
589601
589701
589801
589901
590001
590101
590201
590301
590401
590501
590601
590701
590801
590901
591001
591101
591201
591301
591401
591501
591601
591701
591801
591901
592001
592101
592201
592301
592401
592501
592601
592701
592801
592901
593001
593101
593201
593301
593401
593501
593601
593701
593801
593901
594001
594101
594201
594301
594401
594501
594601
594701
594801
594901
595001
595101
595201
595301
595401
595501
595601
595701
595801
595901
596001
596101
596201
596301
596401
596501
596601
596701
596801
596901
597001
597101
597201
597301
597401
597501
597601
597701
597801
597901
598001
598101
598201
598301
598401
598501
598601
598701
598801
598901
599001
599101
599201
599301
599401
599501
599601
599701
599801
599901
600001
600101
600201
600301
600401
600501
600601
600701
600801
600901
601001
601101
601201
601301
601401
601501
601601
601701
601801
601901
602001
602101
602201
602301
602401
602501
602601
602701
GGAAAGATAACAAACAAGAAAAAAACAAGACACCATATTATCGATGCTTTTTCTGCTTTTTCCATCGTTTCAGCACCTAGTATTGCGCAGTTATTCACCT
ATTCTCCATGAAAAATCTCTTTTCATCTGCAGAATTCCCTCCCACACACCCCCTTCCATAGACTCTATCCCATATTTTTTCAAATCTTAACTGACTTGAT
ATCTGTCTTTACCGATCAACTTCACCTGTACAAAGGGAAATTTGGAGTTTTGCGTTAGTCTCTTGCTCGAAACAAGACAAATAAACAGGTAGAAATGCAATAAAAAGCTTACCAAACACAAGATCCATTGTTCCAATGACGGCGACGGCATCGGCAAGCAAGTGACCCTTGCAAACGTGGTCAAAACCAGCCAAGTGGGCGAAACCGGGTGCCCTGATGTGGACACGGTAAGGGCGCTCGCTGCCGTCACTCACGACGTAGACACCCATCTCACCCTTGGGGGCCTCGATTACCGAGTAAGTGTCTCCGGGCGGCACGGCGTAACCCTTGGTGTACAGAAGGAAGTGGTGGATCAGGGCCTCCATGTTCTCCTTCATGGCGGCGCGGGGCGGCGGCGAGACCTTGTAGTCCTCAACGCGCACGGGGCCGGCCGGCATCTGGTTCAGGCACTGATGGATGATGCGCAGCGACTGGCGGAACTCCTCCATACGGCACAGGTAACGGTCGTAGCAGTCGCCGTTGAGACCGACGGGGATGTCGAACTCGACCTTGTCGTAGGCGTCGTAAGGCGAGCTCTTGCGGATGTCCCAAGGAACACCCGAACCACGGAGCATCACACCGGTGAAGGAAAGGTCCAGAGCCTCCTTGGCTGAGACGACACCGACGCCCTGGAGACGGTTGATCCAGATACGGTTGTCTGTAAGCATCTCCTCGGTCTCGTCGATGCGGTCGCCGAACTGGGTAGCCCATTGGTAAATGTCATCAAGTAGACCGGCCGGGATGTCCTGATGGACACCACCTGGCCTTACGTACGCCGCGTGGAGACGGGCACCAGAGACACGCTCGTAAAACTCCTATCATCAAGTTAACATCTCCAAGCCTCTCACGGACAGAAGCCAATGCTTCAAAAAAGGGCAGAAGCTTATAAAGACCTTACCATGAGCTTTTCTCTCTCCTCGAAGCCCCACAGGAAGGGAGTAAGAGCACCAACGTCCATGGCGTGGGAGAGGACCGACATCAAGTGGTTGAGAACACGGGTGATCTCGCCAAACATGGTCCGGATGTACTTGGCGCGCTCGGGAATCTCAATGTTGAGCAGCTTCTCAACGGCCAGCGCGAAGCACTGCTCGTTGGTCATCATGGAGACGTAGTCGAGACGGTCAAAGTACGGAAGGGCCTGGAGGTACGTCTTGTACTCGCAGAGCTTCTCGGTACCACGGTGCAGCAGACCGACGTGCGGGTCGGCACGAACAATCTCCTCTCCGCTCAGCTCGAGAATCAGACGCAACACACCGTGCGCGGCTGGATGCTGGGGACCAAAGTTGACCGTGTAGTGGCGGATCTTGCGCTCAGCGACGCCCGGCTCATTTGCCTCAATGTCGTCCTTGCGGTTCGTCACGAAGTAGGGGTCGACCGGGTTCGAAAAGTCCGAGTCCACGGGCACCAGCCGCGTCGCCTGAGCCTTTATGAGCTCGGCCGGGTCCGGAGTCGTGGCATATCGGCGGCGGGTGGTCGAGGACAGGGATCTTATTGTTGAAGCAGCCGAGGAGCACGAGGCTGAGATGGGAATCTGGGAGGAGGTTGCTGGTCGGAGGCAGAGACGCTTCGAGGCGCCCCGACCGGCCAGGCGGTAGAGCGAGGCCATTGCTGAAATTTATGACGAATTTGATTGATGATTTGGGTAAAGGCCGGTCCACGAAGAGGTCAGCAGCATGTGTCCTCCCGAGGGGCTCCCTCTTTGTCGGTAGGCAATGGCTGCAATCCAAAGAGCTCTTGAACTTTTTGATAAAGTAGGAGGGGGGCGACAAACGATATGTGATGTCGAGAATACCGTGTGGTCATTGACCCGAAGCTTTACCACCTGGGAAATCCCGATTGAGCCTAGCCTCGGGCGAGCAGAATATCCGGCACAAGCGTGAGCTCCACAGATATACCTCTACAGCCAATCACAAGGGCCAATTAGTAAAACACTACGAACCGCCATGCAAATTCCCAAGCTCTGTTGGACATTGGTACCTGGAAATTGGAGCAATTGATGCAAGACAGAAGGGGATTTTATTTCATCGTGCAGAAATATGCACTTGCGAGCTAGAAGAACGATTACTAAAGCTGTTCTTCATCCAATTGATAGCAGCAGAATATGAAGCTGCCTGAGTTGACATAGATAGGCAGCTATCTACCCATGAGCTTTTGACACAAGGTACCTTGCGTGTAAGATCTGATCCTACCTACAGGAACAACACAGCTGACATGGATTTTGTTGCAACAAACTGCAAGCCTTTCTGATAGATGCAGGGTAGGCAGGCTGGGAATGATGGCATTTTGGCTAAGAATTTGAAGCAGGGATTCTTCCCCAAGTGAAAAAGGTGGGGCCTGTCTGGCAACGCCCTGCAGCTTTCTCCCCGCCAAAAGTTTTGCGACGCGGAAAAAAAGTTCAAGAAATCTAATCGCGATATCGTCCATTGGAGTCTTTGAAGCCGTAATGCCTTCACAAACAAGTCTGAGCTCTGAAGAGCTGAACAGGCGAAAGGTATGTGATTTGGTGATACCTGAGTGCTCCATATATTTTTCATAGGTAGACGATAAGAGCAACTAAAAAAACCCAACCACACAGCTTGTTGGTATCAACAAGGAGACAGTTACAAATACGATATCGACTGATTATCCTGGCGCACACTATGGCGAGGAGCACGCCTGGGACGTGAACGAGTTTTCCCAGCATCTCAACATACAATTCCACCAGAATGACCCCAGCCTAGCGTCATTCAGTCTAATCGGCGTCGACGCCTCCATCGCAAATGCCTTCCGCCGTATCATGATCGCCGAGATCCCCTCCCTCGCCATCGAGCGAGTTTTCATAACCAACAACACCTCTGTAATACAGGATGAGGTGCTCGCCCAACGCCTGGGTCTCGTCCCACTCAAGGGATCCAAGGAGGGCCTGCGCAAGTTCATGAAGCCCTTCAAGAGGACCGAGACGGGCGGCTTCGACAACTCGTTCGACTTCAACACAGTGAACCTCCGGCTCAACGTCAAGTGCACCCGGAACCCCGACGCGAAGCCGGGTGAGAATGACCCGAACAAGGCCTACATCAAGCCCAACGTCTACGCCAGCGACATCGAGTTCGTGCCCGCCGGCCAGCAGACCGACTACTTTTCGGGCGACGGCGCCATAGTGCCCGTGAACCCGGACATCCTGATCGCCAAGCTGCGGCCGGGCCAGGGCATCGACCTCGAGATGCACGCCCACATCGGCTACGGCTGGGACCACGCAAAGTTCTCGCCCGTCTGCACTGCCTCGTATCGCCTCATGCCCATCATCGACATCGTCAAGCCCATCGTCGGCGCCGACGCCGAAAAGTTCCGCGACTGCTTCCCCGACGGCGTCATCAGGCTGCAGCCCGTCACCGCCGCCGAGGCCAAGGAGAAGGGCAGCGGCTACGAGGGCCACAAGGGCGAGATGAAGGCCGTCGTCAACGACCCCATGCGCGACACCGTCAGTAGGGAGTGCCTGCGACATGCCGAGTTCGAGGGCAAGGTCAAGTTGGGCCGCAGGCGGGACCATTTCATTTTCTCGATTGAGAGCGCCGGGCAGTGGGATAGTGATGAGCTCTTCCTGGCTTCCATCGCGGAGCTCAAGTCCAAGTGCAAGAAGCTAGAGGAGCAGGTTCTTAACATGGTTAGGTGAATGAAAGCATATTATCGGCTGTTTCTTGTCAATACTTGTACGTTTCATCTTCAGGGGCTGCTAAAGAAAACGTTGCTCATCTGGCATTTTCCGATCTCTTGTGCGGATTCCGGTTTTGTTTTTACATAGATTTTTCATTGGGCACGGCGTCTAGGCAAGGTTTGGTACTGAAGAAAAAAAACATTATATCCACCAACAAAATGTTTTTTGTCTATGCTTTAAGAGGACATATCAGATTCGATTCGGCCCAATCCGAGAAAACATCGCTTCCAAGTATGCATCAAATTCAAAAAGGTTGACTGGACAAGCTTACGATGAAAGTCTCCAAAAAGTGAATAAAGTGCTTTTTCTTAGAGAACGCCGCTGTTATCCGTCTTCACTTGAACTGCAGCCTGTATTGGAATACCGTGCTCACAAACGCCGGGTCCGTCACGGCAATCTCCTGCCCGCTGACCAAACCTAGCTCGGTCAGGGTTTTGGTGAGATTTCCCCTTGTGGCCTTCTCGAGATCGGGCGTCATCTGCACGTACAGCGACTTGCCTTCGGCGCGAATACTGGGCTTCTTGAGCTGAGCGGCTGGCTGGACCGCGAGGTGGTCGACGAGCTCCTGCAGCGTCCAGCTCGGATCGACCTCGAGCTGGCGGGCCTCGTTCCCGCAGACGGGGCAGTCGGGTTTGCGCTCGTACTTGTAGGTGAAGGTATAGATGCCGGCGTCTCCCGTATACATCATGTAGTTCTCCTCAAGGCCGAGCGGGGGTGCGGCGTTGCTGGCGATCTTGAAGGCCTCGTTGCAGCAGCTGGCGGCGATTATAGCGTTGGTCGAGGCGATGGCGGGGATGATGTTCTTGACCACGCCCTGGGTCAGCGAGTAGGTGACACCCTGGATGCCATACTCCTTGGCGCGGTCCGCCGCCTTCTGGAACAGCCATGTGATGTGCTCCGGGTCGTCCTTGTCTAGGGCTGGGAACGGTTTCTCCTTTTCCCAGGCGATAATGTGTGCCCACTCGATACAGTGCTCTGGCTGGCGCGGGATGGTAGCGATGGTGCAGAGCGGGACGGCAGGCCGAGGGGCGTAGATCTCGAGCTGGCACTCGATGCAAGCCGTCATGGTGGGGAAGATGACCCGAGACTGGCCCTTGAAGCCTTCGGTGCCGCCGTCGATGAGCGGCTTGAAAGAGTCCGGGTTGTCCATGTCAACCATGTCGCACAGCTTGGCGTTTATCCACCGGCGGGCCTCGATGCTGTCCAGCCCGCAGACGACAAGCTGGAACTGCATATAGAAGTCGTCGTCAAACTCCTGGATGCGGCAGTTATGAGGCGTGATCTTAACGTCCTTTACCCGCTTCTCGACAAAGCGGGCGGCGACTTCTGCCTTGTACTTTCCAACATCATCCTTGCGGAACAGAAATTGCCTGTTCAGGTTGGAAATATCTATGGTATCTGCCGGTGGTTGAGAAAATGTCAGGTCACGTCAAATCGGATTGGAGATATTCCTGTGTCTTTGAAGATCCAAGCAGGTATCTTTTTATGAAAGGCTCCCTGCTTACCCATGTCGATAACATGTATGTTTTTAAAGCCTGTCAAGGCCAGGTTCTTCAAAATCTCACATCCAAGTCCGCCAGCACCTCTGGGAAGTGAGGGTGAGTTTCCGGTCCAATTACTCGAATTTGCCAAGAAGGTGATGGTCGTACATTACCCTGGAAAGAGTTAGTCCATCAATGCTACAGATCCGGGGTAAGAAGACACCAGAATATGGCCTACGTACAGAACAGACATCTTTTCCATGCTTGAAACACAGCTATCCGGGTCAAAGCTGTCCATGTCAGTGAAAGAACCTGGTTTGGTCCTTATTCTGTCCAGATAATGCCTGACAATCAAATGTGTCAGTGTTTACATGCAAGAAATACACAGTGTTCGATTGGTAGGTTACGTGAATACCATCGTTGTGAGCTTGTATCGACACCGGCAATCATCTCTGTGTCCGCCGCCATTTTGCCCGTCTTCTATGTGGAAAAGACGGTGACCCGCGTAGATATATTATTGATCAACAAGAGAGCAATTTAAGTACCAAATCAGGTTGTAGTCTCTTGATCTTGCTGTGTTAAGATGACCGTAGAGTATGGATTGGGACCTTTAGGTGGTGAGATGACCAAGAATAGCTGGCTCTTAAGAGAGTGGAGGTGAAGTCACTGGAGGTATCCCGGCGTGCTTCCCCGCCACAAGGCGGCAGCTGCTAACCCCTGTACAGCGAATACTATGTACGTCTCTTATCGATAAAGCCGTAGGCCTGTACCCCATGGGTTCAGCGGACTGCAGAGCCGCTAAATGCATCTGCCTACAGTACAGGCACTATCACCCATGAGTTCGTCCAATTATCTACCTCACAAATGGCTGCTCGCGGTGCTCAAATCCTGGTCAGCTGCACTGTGAAGTTACCAAAAGCAGAAGCCTGGATGGAATCTGCTGTCGGCTCGCAATTTCAATGAGAAATTACATGCAAATTGACGCCGCACATCTGAAGCGCATTTCGCTATCCACCGGGGGAAGATGTCGCACTGAGTTCTAGTTTCTTCCATGCACCAAGTTTGAGTTCGCGCAAAGCAACTCTTAATTTCCAATATGGACGATTTACTCACACCAGTGAGCCAAGTGTATACTTCAAACAAAGATAAACAGCCACTTTTACAAGAAGTCACTTCCAGCTCCCGGCTCATCAAGAACAAATCTAGTGCTACAGGGTCTAGCTTGTCGAGCTACGAGGATGCCTTGGAAGCTCTCAAGGCCGAGCCGGACTATGATACCCTTTCTTCCGTCCTCGATTTTCTTCTCAACGGACACACCACCAAAACACAAGGCGCACCCTGCAGTGTTCATCAACCAAATCCCCTGAACTCGCAGATCATACAGACGCTAGTCACCGGAATTGTACCGAATTACTGGCAGTCATTAAAAGACGAGGCTGCTAAGGAAAATCAAAATCTTTCTCAGTCACAAACCAAACAGGCCCCTTTACTGCAGAGACTGCTGAGCTGTCTTCTCAACTTGACTGGGGTCAACGTCATCTTGACTCACCTGAGAGGAATTGTTGGTGAGCTAGGAACCAGCACGGACGAGACTCAGAGGTCGATGATGAGCTTGAATATAGCCACTCTGCTCGATCTGCTTTGTTCGCTTCTGCATGGACACGGCGCCTTGCACCGAATTTGGACCAACAGCTCCCGAACTCTTGGCAGTGAATCCATGCTTCGACCATTAACTCAGGAGTTTGTCAACGTAACTGGCGGCGGCAGAATTGTCTCATTGGCAGCAGAAGCAGAAAGATCTGCCCGAAAAACCTCAGGTGAAACTAATGCATGGGTTGCCAGTAGTAAAGACTACAGTAAATGGCTGGTACGGAACATCGTTAACTGGGCTCGGGAAGATTCTTTGGAATCGCCTGGAAACCCGGTCTCTCAGCTACTCACCAAAGCTCTCCAGCTAGGTCATACCGGTATGATATATCTGATAGCCTCGAACCCACAGTCCAAAGTTATTTGGAGACCACAAAAGCTGACCTTAATCTTGCAGACCTCTTGGTGGAATATCTTGTAGAGGGGCTGCTTTTAAGTGCAGTCGAAAAGGATGTCGAGTTATTCGAAAAAATATTCGGCAACCTGCCTCAGCATGACCAAAAGCGCCTGCTGATGGCTATTCTGAAGTATGCCACCAATGTTTTCAGCAGCCCGGAGAAATCTAAAGATGAAGCGTCTGTTGTATCTGCAGTAGCAGGACTTCTTCGAACAATTGTCAAAGTGGACGAAAAGAGAAGGGGTATTTTAGTGGGATGGCTGACCTCCGTTTCTGGCGGTGCTGCGGGCGAACATGTGGGCATCCGGCGTGCTGCTGTTGGCGTTTTGACAGAATACCGAGACGACATTACCATTGTGCTAGAAAAGACCATGGCTTTATTTGGCGATAATCTGTACATCAAGCATGCGCCACTGCTGCAGCAAGAAGGTAAGCTCCCCGGCTCTTTGATCTCATCATAGGAACAGAACTAAATCTCTCTCCTGCAGCACATGCGCAGATACTGCTACTTAGCGCTGGCTATGTTCACCGTCTGAACCCTGTCAAGCTTGCTATCCTAGTTAAATCTGGCGTCTATCTCAACGCTGTCTCGAGTAGGCTGAGTGCTCCTCAGACAAGGGCCCGCGTTCTGGGAATGATTGTGGGCGAAGCACTCTCTGCCCTCACACAGGGTAGCGGGAAGGCTCTCAACTTCGACATGGAAATATTGAAGACCGACGAGGCAAAATGGTATAAAAGCTTGGTCGAAGTGGCTGACACGGCTGGCTCTTTGGAACCATTGCGCCAACGCGTCAAAGTTGAACTTCCAGAATCCAAGGTTGGGACTCAGACTCAGAGGCCAGCCGAATTTGTGAAGCCGCCGAAGAAGACCATACCAAAACCAGCTCATCGGGCTACCGGCTTTGTGATTGAGGAGGTCAGCGAAAGCGAAGAAGAGGATGATAATCTCGTTCCATACGCCAAGCCTGACTCCGATCGGGAAGACTCTGATGATGATGCAGAGCTAGTGAGCAGGAACAAACCAAGAGCTCCTGTCTATATCAGGGACTTGATAACATATCTCAGAGACTCAGAGAATTACGACAAACAGGAGCTCTCTTTGACTACAGCGCCTGTGTTGATTCGACGCAAAGCCAACTACGGTACCGAAGTCGTAGATCATGCGGAGGAGCTGGCAGGGCTGCTGGTGGGAATACAAGACAAGTTCAACCTGGACGACTTTGAGTCTTTGAGAGTCCAAGGAATGGTTTCCATCATAGTAGCACAGCCGCGGAAGATGGGTCCTTGGTTTGCAAAGACATTCTTCGATGGCGACTACAGTCTTTCGCAGCGTGCTTCTGTCCTGACTGTGCTGGGACTTGCAGCAAGGGAAATAGCAGGCTTTGAGCAGTCTGAATTTGCAGATTCTGCATATTTCCCGTCCAAGAAACTCCCCGAAAAGGTAGAGCAGTTCTACCTGGCGCAAACCGGACAAAATCAAGTTGCCGGGGGTTCAAATCTCAAGTCGCTGCCCCCAAGTGCCATAGACAGTATTGCACAATCGATAACATCAGGCTTCCTGGCACCAATGGTGGCAAACGCGGCAGATGAGCAGACAGGCCCTGATTTGCTCAAGCTCTCGTCTTTCGCATCCCGGTTGCAGCAGAGGCAAGGTTCTGGCAACTCACCATTGCAGAAGGGCCAAAAGAAGGCAGGCGTTCGCGCGATCCCAAATACCACGGCCCAGCTGATATCCGCATCGTTCTTCTTCCCCCTGACTGCACGCTTCCAGGCCGCGCTGAGCTCGTCGACGTCTCGGGCTAGGACTATTGTCCTACAACCTGAGCTTCTCACCCACCTACTCCGCACCCTGGGTATCCTGGTGCACGCCGCTGGCCCATCAACGCTGTCCCTGCCAGACATGACGGCCGAGCTCTGGGGTCTGCTACTCGGCAGTGCAGTACGGGCTCGATGCGCGGGAGACCTAGGTGTGACGCGCGCGGCGCTCTTCGCGCTGCTGGCACTGCTTGAGGTCAACGGGAACGAGGAGGTACGCATGCGTGACATTTGTCGGGAGCTAGCACGCGAGGTGGTTGAGACGCAGGAATGGGTGTCGCAGGTCTTTGAGAACACGCGCGGTGGCGATGGGGAAGGCGGCGAGGAGAACGAGGTCAAGCTGTTGGCTGCCGGGGTGCTCATTCGGCTCAGGGATGCCATGGAGAGGTTCCGGGCCTTCTTGATTGGAGACATGATTGGGTGATATTTGACTGTGTGTCTTAGCGTCTGCACTCAGAAAGTACTTTTGTGTTGAACCCCCAAGTTGACAATTATAAAGCTCAAGTTACTCCTCCGGTTCAGGGGTTCACCGACCCTTCTTCCTACCTACCCTGCACTTGACAATCGAAGACTACGGAGTGGGCCATGACGGAAGAGCGACCCATAAAAAAGTCCAGAGGTAGGTCGGCGCAATGGAACGATTGCGACGCCATGATTTCAAATCAACGAGAACATCAACTACACACATTCTTTCACACAACAAACCGTGACAATGGGACAGCAAGCTTCAGTACCAACAAAAATGCGTGAGTGTAAGGCCTGAGATTGCATATCAAGGTGGCTTTTGGACCCTAGAACTGACACATACATGCGCATGCAGCTGCAACCACCGCGCCGGCGCAAACCGCCAATGCAGCCGACGCCAACAAGCCCAAGGTGCGATTTTTTTTTTTTTTTTTTTTGCGAACTTGCTCTCTCGAGAATCGAAGGGTTGATCTGCGCTAACAACTTGCATCAATTAGCCCTGCTGTGTTTGCAAAGATGAAAAGGCAGCTCGCGACGAGTGCATGCTTTTCTCCAACGCCAAGGACCCAGCCGAGGATTGCAAGACAAAGATAGAACAGTACAAGAGCTGCATGGCGGGCTTTGGATTCAAGGTCTGAAATGGGCCCTTTGCGCACCTAGAAATCGGTCGGGCGATCGAGGGGCATAGACTGTACTATACGAACGAGGGGCCACTAGAGCCGACCCAGTGTACCAACAAACTACCTGTATCGAACGAACGGCTAAGACATGATAGACACGGCGTTTTTGTTTAGAAACTTTTGAACTCTAGAGGAGAGGCTAGCACTGCCTCCATGCACTTTCACAGTCCTCCAAATGCTTAGACGGCTGAGTTAGTGTCGAAACTATATGGTCTACATATACACCAGTCAATTGTTTTGTGCACTGCGGCCATCTTGTACATCCTGACCAAATCCAGGGGAAATCACTAACAGCCTCGTCCGCCGAACTAACATGCTCAGGGGCCGGCTACAGAGAACAAAGGTTTCTGGTTCATCCTCTCAAACCCCTGTTTTCCACCGGGTCGTTTTACAACATTCTCCTTGGAGATACAGCTTGAGCATGAAGGCCCCCAAAGCTCACGGCATAGCGGCCGCCTTACTTCTGTACTCTTTGGGTTCCTCGTCACCGGTCTCTGGGTGCGTGATGCAGATATCCGGCAACTCTGCGGCTCTCTTCTCCACTACGTTGTAGCCGGCCTCGAAGTAACGCCGAAGGCTACCCAACTCTCGTTCCAGACCCGTCAACTTGGTGGCGATTGTTGACTGGGTCGTTTGTCTTTGATGCAGCAGCTCCACTAGCCTGCTTAGGTCCTTTCCTCGGGCTTGGTTGCTTGAAAGCAAGAAAACAAAGGGTCAGCTGAGTGCGTTGGCCTTGTGGCAGTTACAATATTGGGGTCCATACACTTTGGTGCTCAGGGCAGTGATGCGGCCTTTGGCTCTCTTTTTGACGCCGTCTACTTTGGTCAAGTAGTCGGTGCGGATCTTCTCAACTCGCTCATCAAGACGTTTCTGGATCTGCAGGCGAGTGTCAGATCCGGGTGTAGCAGACTGGGTTAGGCGTCACCGACTTGAATTGCTTTGAGATCCGGCGCCACTGCGGATGAGTCTTCAGGCTTGTCATCAGAGGGCGGACCTCGGATTCTGAGGGGTTGTCTCTTTGGAGGCATGACGATCCAAACGGAAGCCAACGGAAAGCTGGCTGTCGTGTCACTGAAAAGATTTTGGCGTGGTTGTCAGGTTGATCTCCTAGTCCTTGTGATAGCGCCGTAAGAGTGAAGGCTGTTACAATGATTGATTTGAGCCAGAATCATACCGTTTCTTGTATAACGGAACGTTTTTCAAGTAACTCTCGCTATCTATGTGCGCAATTGGACATTTCTAGCTGCTGAAAACCTACGCCTTCCCATTTTGGTTTGCTGGACTTTTGCGGACCATATGGCATGCTTAAACAGGAAGGGGCTCCTATCTAAGAAACTGCATTCCCCTCAATGGACACAAACCTGCAGTATTAGCCCGGCCTCTACAGCCCTCCAAGGCACATCTCCAGGCCAATACTAGCGGGATTCTCTCTGCGAATATATAATTCGACTACCAAGTGGACTGTATTGTTTCGCCGAAGTTCAACGACGGTATCTCGCCATTAGTGCTCAGGGTAGCAATATGGACCTATATTCTGTGTGGAATATGCGTGCTACAACTAAGTGCGTAAGCACCTTCCTAGCGACCAGCTACCTTGTCTAAGGCACGTATGCATTAAATACCTTATATTGGAGGATGTAGCGACTTCTTATTGTCGAGGGTCAAGTGCATCTATCGGATATGTCCGTCTACCAGGGTTAGGGTTGAAGCATTCCTGGGCTCACTCATTAACTATTCTAGATAAGATAAGACAATTAATGTCCAGGGTTTGCCCCGCCAAAATTTTCTCAGGTCGGAGTTCCCTTCAACGACGTGATCCGCGCATTAGTCCCATCCCCAGATACCAAGATCCAGCTGCCGGACCGTCCTCGTTCGGCATTCCACAATGGGTCTCGCTGCCCCAAAGAAGTGAGTGGCCCAGTCGCCGACTTTGCGCCTCCAGAACTGACATTAACCAACAGCAAGCGCAAGCTTGGCAACGACCCGAACAACACGAGATGGAGCCGTAACACCGAAAACTTTGGGCACCGCATGCTTCGGTCCCAGGGCTGGGAGCCCGGCCAATACCTAGGACCACAAGATGCCTCCCACGCCGTCTACCACACGGCAGCCAGCGCTTCGCACATCAAGGTCGCGCTCAAGGAGGACAACCTTGGACTGGGCGCCAAGATGAACCGCGGTGACGAGTGCACCGGCCTCAACGCCTTCAAGGAGATGCTGGCGAGGCTGAACGGCAAGTCGGAGGCCGCGATCGAGAAGGATAAGAAGGCCAGGGAGGCACATGCCATGAATGTTTATGTGGAGCGCAAATTCGGGACGATGCGCTTCGTGAGCGGCGGCTTTCTCGTCGGCGACGTTATCCAAGAGAAGAAGGAGGATGCCGAGGCGGAGAGCACAGATGGGACACCAGAGCCTGCAGAGGCGACCGTGAAGAAGGAGAAGAAACGCAAGGCTGGGCGAGACGATGATGATGAAGCACAATCCAAGGAGGAGCGTCGGAGAGCCAAAAAGCAGAAGAAGTCCATGAAAGAGACGGGTTCTGGCGGCGACGACGTTACATCCGAAGAGGACTCGGCAAAATCCAAGAGTAAAAAGAGCCACAAGAGCAAAAAGGAGAAGAAGCGAAGGAAAGAAGAGCCGGCTTCTGACGAGCAGGAATCCGAGGATGAGGAGAGCCGCGAGAAGCGGAGAAAGAAGGAAAAGAAAGAACGCAAAGAGAGGAGAAGGGAGAAACGGGAAAAGAAGTTGAAAAAGAAGCAGCAGCGCGAAGAGGACAGTTCATCATCGGAGGCTAACTCGGACGACGAGACCACCGGGGTCGATACCGGCGCGTCTACGCCCGTTGCCAGTGGTACATCAACTCCTGTCTCTCAAGTCTCGGTTCGTCACCTTGCCAGGAGACGCTTTATTGCCCAAAAGCGGATGGCTATGAAAGATCAACAAGCACTGAATCAGGTAAGACACAATTCCTTCGAAAGTAAGCCTCAAGGCCGCGACGCTAACATTTTTGAAGATATTCATGATAAAATCGTCCTAAAGATTACTAGCCAGCGACAGTTATTCCCCATACAAATAAATATCCTAACATTATGACCTTTGACCTGCAAAGATTTGTTTTTTCACGTCCGTGACACCCCCCGAACATCTCGATTCCTGGTACAGTCTCGTTCGATTGAATTGACACTAGAGAGAAATTGTTGTTTTTTAAAGTCACGGCAAAGCCATACGGTGACTTGACATGCAGTCGTAAGAGAGCATCTGTTCTGCTGGGCAATCACCGCTGCTAACCCTGGCAGGCAACTCCAGGGTTGATTGCACGCAGTATAAATTTGTAAGAACATGAGATGCAGATGCGCCTCGCTACTCAGCACCCCTCATCAGAATAGGTTGAGCCTGGCGCAAGCGAAAGGAGACCGACTGCCTGACTTCGTTTCAGGAACAACCTCCCGTCGACTGTAGCCCACCGAGTTATCGTCACTTATATATTAGTATAAGATATCGTTGGTAGGCTCAAGCATTTGCCTCACACAGCTTCGGGGTGACATCAAAACTCTCCGAGAGGTCCCTCCCTCGAGTTTGCCAATTATGGACGAACAAGTATTTCGAGCGGATTCCCTTTCTGGGAATACATATGAAATCGACACTGAGGCACATGTGCAAGGCGAGACCGAAGGGTTGCAGTCTGTAGAGGTGAACGAACCTGTAAGCATTTTGCCAAGGCCCAGCCGGAAAAATTAAACCATTTCCCCATTGAATAGTCGTTGAGCTTGGGGGCTTGTCTGATCATGGATTCGAGCCAGTGTTGTGCGACCGTGAGAATGATGGTGGCCAAGCTCAAGGGGAAGAACCCAAAAAGACAGCACTGGCACAGAGAGAAATATATCGTCGTGGTCATAGCAGGAGGGGAAGCAAAAGCCGGAGCATGGACCGAAGTTGAGACCGATACCTTCCAAGGTCCGTGTCAACGTCTTCAAGCCAAGTCTCCAGTCATTCATCAGGCAATAACCTGTACCAGGATTACCGCGAGTTGTTCTCCAGTTCAGCGTTCAATACTGCCCCTTGGAACTCTCCTCCAGTCCCATTCAGCTTAGACAGCGAGGATACAGAGACTCATACACAGCAGCTGCGAACCAACGAGGTCTTGATGGGAGCGAGGAACAGCCCTGCGATCGAGATATATGATCCCAAGTATACTGGGAATGATCTGTTCCAAGGGCCTCGCCATTCTAAGCTTACAACATTTCAAGATCCAGAGAAGCAGGAACGGCATCTGTTTCGTGGACTATGAGTCCACACATGACCGCGATAATTCTAATCCGAGAGCAGGAGACTGTGACACGCTTGAAAAGGCATCTTTGGCAAGATATCTTGAATTTTGAGAGCCTTCAGGTTGGTGCTATTGCTCCCTGGTTGCCACCTCCGTGAATCTGCGCCTCGCTTCGCGTTTTGTCTGCAAGAGCTAATTTGCTCGGCTATAGACATGCTGGTCAAGTTCCACTGCTACGTTCTAATGACCGGCTCAATCTCATCACTTTGCTAGAAGATGTGAAGCAAACATTTGGTTATGGCCCAAACTTGCTGTGAATGGCAACCATGTCTCGTTCATGGAACCAGGTCATCACAAGATATCTTATACAAAGTATTCGGGTCTAGTCTAGGAGCAAGTGCGGATCCTACCTTATATCCTAACCAGTCCTTGATGCAAGCTCAACACAGCCAGATGGTCGTGACCATGATATACAACAGGCTATCTGCCTTCGTATTCGCCAATCGGGGTGTGTTGTTGTGCATGACTGTGAGTCAATGTCCTTATTGTACAGACCGAAGCAAACATGCCCCTAATCACTAAGATCTATCTTCGAATCCCCAGTATGCCTCATAACCTGTGGGGAGATGAGTTTGAAAGAAGGACATGGAAAAGCTATTACGCTTGTTAGTGAACCTCTCAGAGAATTATCCAGGCCAATGCCTTTTGACCCCGTATCTTATGCCGAGTCTACATGGTCTCTGCCTCTTGACGATTGCCAGAGCTGGTCTGTGGGTTAGATCCGATGCTTCTAGGAAGTACTTCAAGTGCTGCTAAGCACTAAGCTGTATGCATCCAGCCGAGGTCATTCAGCGCTTCTATTTACCTATTAGGAAGCGAATCACCCACTGCAGCAAAGTTTCTGGGGCTATCCATCGGATTTTGGGAGTAAGCTACCAGCTGCTAATGTTATATGTATCAAGAGAAAGCCCTTCGTCTCAGCTGTGGTGCTCACCAGTACATTATAGGCCTACAATGAGAAGTCGCCATGCAGACCGAGTCTTCGTCAAGAGCTTAGGTCCCTCATCCAGCCCATCCAAGCTTTTGTGAGTATGATATCGCGTTCTCAAATAAGTTGATCCGGGGTCTACAGCGTCTTTATACCGAGGCAACTGCCTCGGTCGTGGTTACATGTTGTTACGAGTCGCGTTTACTTTTTCAAGCGATTCGCAAAGGGGAGAGTCCCATATTTTTGCTGCGAGCGACCTGGTCGGTGAAGGAATTAGGGAGGCCGTTGATCAACTTCCCGAACCAGACAGTTTGCTTGGGAAAGCCGTCGTGCTGCTATCAGACCTCGCCGCTGTCTTCAACTTGACCCTATTGAGCGATGCAGGGCATAGCCAGGTTGACATCAGGAAGATGTAACTACGAATGCATTCAAAAGCTGGTATGCTATGTTTATAAGTCGGTTCAAAAACTTTCGAATATCTTCCGCTAAAAGCATTTGTTTGATTGACATAGGATTCAGACATCAACACCAAGCCATCAGCTCGTCGTCTGTTGCAAACGGCCAGCCTATTGAAAAATGAACCCCTGGTTGTCCACGGTGTCGTGGAAACACAAGCGCGAGTGATTCGGGGGCTTGCCTCCACATCTCAATCATCGGATTCCTCGGGTGCTCGGGCAAGATGTGTAGGCTGTGGAGGTTACTATGGAAAGCCTACGTATCGTCTTGCCTGATACCAGGGACACCGGACGGCAAGAATAGCATCTTACGGTAGAGATCAGCAGATTGTTGAGGAATTAGAAGACACCTCGAACGAGCGGTTGATCGTTCAGACCAGCTCAGGTCGTTCAGTCACACAAACAAATGGCAATTCGGACCGAAAAGGTGGTTCGTTGAGGATATCAAACAGATATCATCACGCGATCCTCACAATTGGTGAGACATGTCGAGGCTTGGAGAAAAAAAAAACTGTGTGTATACTTTGAGCAACCTTCATCTTGATCCGCTATACTACTGGGATTTCCACAGGCTGACATCACCTGTTTTGCCCAAACTGGTATATTTTCCGACCGTCCAAGCATTGGTGGGCTGTAGATCGAGGCCGAGATCAACCTAGCCAAATACCATCAAGAACTAGCAATATATGCATTCACTATCGTCACCGTCGTTTTCCTACCACTTTCTACTATAGCATCCGTCTTTGGAATGAACATGGCAGATATCCGCGAGATGGAAGTAGGACAATGGCTATATTGGACGATAGCGCTTCCGGTTACAGCTTTGGTGATCCTGCTTGGTCTCTGGTGGATGGGAGAACTCGATAACGTTCTCAAGCTATCTGGGAGGGGGCAAAGCGTGATGACAGTCAAGGAAGACATGGCAACTCCCAAATTCGCGCCCTTTCCAGTGAGGTATCCTGTTCTTCCAGGCGTGGAGAACGTTACGGGCCGACTGCTTCCCCCCATCGCCCAGGAGTGGGCCTTACACGTCGCCGCCGCCGCCGCCGCCATCAGGAGTAGCATTTCCACCAGTTCCGTTGTCAGGACATCTTGGAAGACGAAAAACATGGGCTTGTCATGCAACAGGCGGCTGAGGCGAGTCTTACGATGCCCCCTGGATTCCATGAATTTGACCGAACTCTTATATCTAGGGTTTCACTGTATATCCAAGCGCTGTTGAGTGCCATGTTATAATATCTTGCAACCGGGAACAGAGTTTAATGTGATGGCTGTCAGGAGAATTATTAGAGTGGCCAATAGTGGTTGTGTCATTTGAGCAGCAAGAGTGCATTTGGAAGACCTATGCGGAATGTCCGGTTTATACAATGGGTGACGTCCCTGTGATGATACCTTGCATACCCGCTGTTTATGTAGCGTTGGCTCGAACTACTTACTGTACTTACTGGATCAAGGAGATATAGTCGCGAGTCAGGACTGCGCCCTACCTGGAACGATCTACAATCCAAAAGCGGGAGCTACTACGTAGCACTATGGTATATGCGTAAAAAAAAGTTGAAAACAGGTCTGGGGCACTGCGAGAAAAAAGAAAAGAAAAAAGGGTCCTCCAACAAGATATCGGCTGGCAGAAAGCATGATCCCATCCAGCCCATCCATGTCTTGCCTCCCCGCTTGCCCCCTCCCCCTCCTCTTGCGTAGATGCTTTGCTTCTTTTGACCATGGGGAAGCAAAACTGTGGCAACCGGGACCTGCCATCCGTCCAGTGGTAAACACCAGGCCACCTACTGTACGGAGCACACCTTATGCAGGAGGTTTTGGAAGGAGGAAAAAGAATTGAAAGTCCGCCAGGGTCTAGAACTTGCAGAGGACCATGCCGGAGTACGTGTCTGTTCATGTTGGGTGGTGCCTGCAGCTTCTACGGCCGTCCGAAAAAACTCCGCCCGATATGTGCATGATTTTTGGGGGAAGAGGGCGTTTTGTTTACGTCTAGTTCTAGTCTAGAACTAGAACTGCAGTAGTGCTAGTTCCCCCCATTGCCAAGGCTCAACTGCGATTATATTCCGTAGCGCAGTGGAATTTAGTATGGTACTACGGTATGGGACATGCAGATGAGGCGGGTATCCAAGATTCAGCCTATTATTATTATTATTATTATTATTATTAGTATTTTGGCGTGTATCCCCTTAATAACAGTAGTATACAAGCACAATAAAATAGACCAGCCCATCCTAATGCAAATATGTGCCCATTTCCTTGCCTGGCTGGTGCGGGGCTGTTGGAGGATGGGGTGGTTTTTTTTTTCTCTCCCATCATAAGGTGCCCAAGAAAGCCAAGGCAGGTTACAGATGAGACGAGCAATTGGTTGGATTTCAGCTCATGTGGTGCCTGTTGTCACCCAGCAAACCAGGCTGTCTCTGGTTTGGAGTGTCACCTGAAAATCCAAAAAAAAAGTTACTTTGCGGTTTTTAGGGGCCTTTGGGTTTTCCTTTTGTGGATTAAAAGAATAACAGAGGGGGTGGAGGACATTAGAAGAAGAAGAGGGAAAAAAAAAAAAGAAAAAAGAAAAAACATTGGCATAAATTGTTTGGTTGATGATAAAGTTTTGAACTCTTCTCCAGGTGAGGAACAAATAAAGCGAAAAGTCCCGGGGTCAAGGTTTAATACTAGGATGGAGGCGCTGTTGGACCGGTATACTACTGTACAATACATAGTATGTACCAATGAAGATGGGGAGCGGGCAACGCAACACGACATGAGCCCATGGCGAGGTAGCACTAAAAACCGCCCACTCAACTGCAACAAGAGTAGGCCAGGTAGAGATACGAAGTAGATGCAGTAAATAGTAGCATTGTTTCTGGTATCACTTATCACACCATCAGACTCGAGATATGCAGCGCAACCCTCCCCACCCTCCGTGGTACGCGCAATCTTTCAGTGCGTCCGTTGCTGACTCGCCAATCAATCAAGCAAGACGCAACGCAACCAACAAACAGTTCAAGACGGAGCTCCGCGGCTATGGTGCCCGGGTGCGGGGGAGTCATCGAGATAATGTTCGACCAAGGCGGTCCTTTCTTTATCATGCATTTCATTTTTCGCCCTTGTTGTTTGCCGCTTTTTCTCTCCTCCCAAGGCATCCTTGGCCTCTATACTTTCTGCTTGGAAAACACACTATTGTACAAAGTATAGTAGCGTTGCCGGCTATTGTCCACGATGCCCAGATCGAAGCTTGAATAATTAGGCAGTTATCTGATTCGTTTTTTTTTCTCCCACGGCGGGCTAGGAGCGAACTATTCCACACAGAGTAGTTCAAGATGCGAGATACTTAGATACTAATTCAGGTAGGTCCAACTCTCTGGTTTTGGCTACTGGCGCTAGGAGGCAACTACGACACCGCTTTTTGTTGAGTGCTTGCGTGTGTGTGGCTTGGTTGTTTTGGTGTTTATTTCTGTCTGTTCTGAAGCCTTCAGCCATCATATGGGTTGGGTTTAGAAAAAAAAAAAAAAAAAAAAAAAAACCCCTAAAATAAAAGAGGCAACGATTAAAAAAAAACAATTACCACAAAAAGAATAAAAGGGACTAACGCCCTGCAAGCCCAGTAGCCACAAAGATCACGCCTCCAACCGGAAGCCAACGGATGGAAACCTAGACTGGCGCAAAAAAGCAACAAGGCCGTCGTCCACCCGGCAGTCTCCAGGCACAAACATCAAGGCACAGATGAAGATCTGCAACCTCTCTCTTGGCAAATTGTGGCTCCATGCCTCTTTGTGTTTCCACAAGCTCCACCTATAGTGTAATAGTGGACTATTTTGCACATAAGAAGCTTTAGATCTTTCCTGGGGAAGCTGGTCTGCCGTTGCGCTTGTTCCTAGTTTTGCTGCACTTCATCACCCAATCTTTGCCTCCCTTGTTCATTCTTGCGTCTTTATGGAGTTAGTTACTTTGCTGTTCTGTTTACCCCGCAAAAAGAGTCTCCCCAAAAAGTGGACACGCAACCATACCAGTGTCCATTATTCACGGCAAACTGGCAAGAAGACACGCGCGAAAATTTAATTGATAACCATATTGGACTTTGCGGGGAAGGAACCTCGTCCAGTTGCTTTACTGGTATTGACATCAGCGGCTGAGCGAACAGGGATCAAGGCCTTTTGCTTACCTAGCCTACGGAGTAGGTATAA
TAAAAAGCTTACCAAACACAAGATCCATTGTTCCAATGACGGCGACGGCATCGGCAAGCAAGTGACCCTTGCAAACGTGGTCAAAACCAGCCAAGTGGGC
GAAACCGGGTGCCCTGATGTGGACACGGTAAGGGCGCTCGCTGCCGTCACTCACGACGTAGACACCCATCTCACCCTTGGGGGCCTCGATTACCGAGTAA
GTGTCTCCGGGCGGCACGGCGTAACCCTTGGTGTACAGAAGGAAGTGGTGGATCAGGGCCTCCATGTTCTCCTTCATGGCGGCGCGGGGCGGCGGCGAGA
CCTTGTAGTCCTCAACGCGCACGGGGCCGGCCGGCATCTGGTTCAGGCACTGATGGATGATGCGCAGCGACTGGCGGAACTCCTCCATACGGCACAGGTA
ACGGTCGTAGCAGTCGCCGTTGAGACCGACGGGGATGTCGAACTCGACCTTGTCGTAGGCGTCGTAAGGCGAGCTCTTGCGGATGTCCCAAGGAACACCC
GAACCACGGAGCATCACACCGGTGAAGGAAAGGTCCAGAGCCTCCTTGGCTGAGACGACACCGACGCCCTGGAGACGGTTGATCCAGATACGGTTGTCTG
TAAGCATCTCCTCGGTCTCGTCGATGCGGTCGCCGAACTGGGTAGCCCATTGGTAAATGTCATCAAGTAGACCGGCCGGGATGTCCTGATGGACACCACC
TGGCCTTACGTACGCCGCGTGGAGACGGGCACCAGAGACACGCTCGTAAAACTCCTATCATCAAGTTAACATCTCCAAGCCTCTCACGGACAGAAGCCAA
TGCTTCAAAAAAGGGCAGAAGCTTATAAAGACCTTACCATGAGCTTTTCTCTCTCCTCGAAGCCCCACAGGAAGGGAGTAAGAGCACCAACGTCCATGGC
GTGGGAGAGGACCGACATCAAGTGGTTGAGAACACGGGTGATCTCGCCAAACATGGTCCGGATGTACTTGGCGCGCTCGGGAATCTCAATGTTGAGCAGC
TTCTCAACGGCCAGCGCGAAGCACTGCTCGTTGGTCATCATGGAGACGTAGTCGAGACGGTCAAAGTACGGAAGGGCCTGGAGGTACGTCTTGTACTCGC
AGAGCTTCTCGGTACCACGGTGCAGCAGACCGACGTGCGGGTCGGCACGAACAATCTCCTCTCCGCTCAGCTCGAGAATCAGACGCAACACACCGTGCGC
GGCTGGATGCTGGGGACCAAAGTTGACCGTGTAGTGGCGGATCTTGCGCTCAGCGACGCCCGGCTCATTTGCCTCAATGTCGTCCTTGCGGTTCGTCACG
AAGTAGGGGTCGACCGGGTTCGAAAAGTCCGAGTCCACGGGCACCAGCCGCGTCGCCTGAGCCTTTATGAGCTCGGCCGGGTCCGGAGTCGTGGCATATC
GGCGGCGGGTGGTCGAGGACAGGGATCTTATTGTTGAAGCAGCCGAGGAGCACGAGGCTGAGATGGGAATCTGGGAGGAGGTTGCTGGTCGGAGGCAGAG
ACGCTTCGAGGCGCCCCGACCGGCCAGGCGGTAGAGCGAGGCCATTGCTGAAATTTATGACGAATTTGATTGATGATTTGGGTAAAGGCCGGTCCACGAA
GAGGTCAGCAGCATGTGTCCTCCCGAGGGGCTCCCTCTTTGTCGGTAGGCAATGGCTGCAATCCAAAGAGCTCTTGAACTTTTTGATAAAGTAGGAGGGG
GGCGACAAACGATATGTGATGTCGAGAATACCGTGTGGTCATTGACCCGAAGCTTTACCACCTGGGAAATCCCGATTGAGCCTAGCCTCGGGCGAGCAGA
ATATCCGGCACAAGCGTGAGCTCCACAGATATACCTCTACAGCCAATCACAAGGGCCAATTAGTAAAACACTACGAACCGCCATGCAAATTCCCAAGCTC
TGTTGGACATTGGTACCTGGAAATTGGAGCAATTGATGCAAGACAGAAGGGGATTTTATTTCATCGTGCAGAAATATGCACTTGCGAGCTAGAAGAACGA
TTACTAAAGCTGTTCTTCATCCAATTGATAGCAGCAGAATATGAAGCTGCCTGAGTTGACATAGATAGGCAGCTATCTACCCATGAGCTTTTGACACAAG
GTACCTTGCGTGTAAGATCTGATCCTACCTACAGGAACAACACAGCTGACATGGATTTTGTTGCAACAAACTGCAAGCCTTTCTGATAGATGCAGGGTAG
GCAGGCTGGGAATGATGGCATTTTGGCTAAGAATTTGAAGCAGGGATTCTTCCCCAAGTGAAAAAGGTGGGGCCTGTCTGGCAACGCCCTGCAGCTTTCT
CCCCGCCAAAAGTTTTGCGACGCGGAAAAAAAGTTCAAGAAATCTAATCGCGATATCGTCCATTGGAGTCTTTGAAGCCGTAATGCCTTCACAAACAAGT
CTGAGCTCTGAAGAGCTGAACAGGCGAAAGGTATGTGATTTGGTGATACCTGAGTGCTCCATATATTTTTCATAGGTAGACGATAAGAGCAACTAAAAAA
ACCCAACCACACAGCTTGTTGGTATCAACAAGGAGACAGTTACAAATACGATATCGACTGATTATCCTGGCGCACACTATGGCGAGGAGCACGCCTGGGA
CGTGAACGAGTTTTCCCAGCATCTCAACATACAATTCCACCAGAATGACCCCAGCCTAGCGTCATTCAGTCTAATCGGCGTCGACGCCTCCATCGCAAAT
GCCTTCCGCCGTATCATGATCGCCGAGATCCCCTCCCTCGCCATCGAGCGAGTTTTCATAACCAACAACACCTCTGTAATACAGGATGAGGTGCTCGCCC
AACGCCTGGGTCTCGTCCCACTCAAGGGATCCAAGGAGGGCCTGCGCAAGTTCATGAAGCCCTTCAAGAGGACCGAGACGGGCGGCTTCGACAACTCGTT
CGACTTCAACACAGTGAACCTCCGGCTCAACGTCAAGTGCACCCGGAACCCCGACGCGAAGCCGGGTGAGAATGACCCGAACAAGGCCTACATCAAGCCC
AACGTCTACGCCAGCGACATCGAGTTCGTGCCCGCCGGCCAGCAGACCGACTACTTTTCGGGCGACGGCGCCATAGTGCCCGTGAACCCGGACATCCTGA
TCGCCAAGCTGCGGCCGGGCCAGGGCATCGACCTCGAGATGCACGCCCACATCGGCTACGGCTGGGACCACGCAAAGTTCTCGCCCGTCTGCACTGCCTC
GTATCGCCTCATGCCCATCATCGACATCGTCAAGCCCATCGTCGGCGCCGACGCCGAAAAGTTCCGCGACTGCTTCCCCGACGGCGTCATCAGGCTGCAG
CCCGTCACCGCCGCCGAGGCCAAGGAGAAGGGCAGCGGCTACGAGGGCCACAAGGGCGAGATGAAGGCCGTCGTCAACGACCCCATGCGCGACACCGTCA
GTAGGGAGTGCCTGCGACATGCCGAGTTCGAGGGCAAGGTCAAGTTGGGCCGCAGGCGGGACCATTTCATTTTCTCGATTGAGAGCGCCGGGCAGTGGGA
TAGTGATGAGCTCTTCCTGGCTTCCATCGCGGAGCTCAAGTCCAAGTGCAAGAAGCTAGAGGAGCAGGTTCTTAACATGGTTAGGTGAATGAAAGCATAT
TATCGGCTGTTTCTTGTCAATACTTGTACGTTTCATCTTCAGGGGCTGCTAAAGAAAACGTTGCTCATCTGGCATTTTCCGATCTCTTGTGCGGATTCCG
GTTTTGTTTTTACATAGATTTTTCATTGGGCACGGCGTCTAGGCAAGGTTTGGTACTGAAGAAAAAAAACATTATATCCACCAACAAAATGTTTTTTGTC
TATGCTTTAAGAGGACATATCAGATTCGATTCGGCCCAATCCGAGAAAACATCGCTTCCAAGTATGCATCAAATTCAAAAAGGTTGACTGGACAAGCTTA
CGATGAAAGTCTCCAAAAAGTGAATAAAGTGCTTTTTCTTAGAGAACGCCGCTGTTATCCGTCTTCACTTGAACTGCAGCCTGTATTGGAATACCGTGCT
CACAAACGCCGGGTCCGTCACGGCAATCTCCTGCCCGCTGACCAAACCTAGCTCGGTCAGGGTTTTGGTGAGATTTCCCCTTGTGGCCTTCTCGAGATCG
GGCGTCATCTGCACGTACAGCGACTTGCCTTCGGCGCGAATACTGGGCTTCTTGAGCTGAGCGGCTGGCTGGACCGCGAGGTGGTCGACGAGCTCCTGCA
GCGTCCAGCTCGGATCGACCTCGAGCTGGCGGGCCTCGTTCCCGCAGACGGGGCAGTCGGGTTTGCGCTCGTACTTGTAGGTGAAGGTATAGATGCCGGC
GTCTCCCGTATACATCATGTAGTTCTCCTCAAGGCCGAGCGGGGGTGCGGCGTTGCTGGCGATCTTGAAGGCCTCGTTGCAGCAGCTGGCGGCGATTATA
GCGTTGGTCGAGGCGATGGCGGGGATGATGTTCTTGACCACGCCCTGGGTCAGCGAGTAGGTGACACCCTGGATGCCATACTCCTTGGCGCGGTCCGCCG
CCTTCTGGAACAGCCATGTGATGTGCTCCGGGTCGTCCTTGTCTAGGGCTGGGAACGGTTTCTCCTTTTCCCAGGCGATAATGTGTGCCCACTCGATACA
GTGCTCTGGCTGGCGCGGGATGGTAGCGATGGTGCAGAGCGGGACGGCAGGCCGAGGGGCGTAGATCTCGAGCTGGCACTCGATGCAAGCCGTCATGGTG
GGGAAGATGACCCGAGACTGGCCCTTGAAGCCTTCGGTGCCGCCGTCGATGAGCGGCTTGAAAGAGTCCGGGTTGTCCATGTCAACCATGTCGCACAGCT
TGGCGTTTATCCACCGGCGGGCCTCGATGCTGTCCAGCCCGCAGACGACAAGCTGGAACTGCATATAGAAGTCGTCGTCAAACTCCTGGATGCGGCAGTT
ATGAGGCGTGATCTTAACGTCCTTTACCCGCTTCTCGACAAAGCGGGCGGCGACTTCTGCCTTGTACTTTCCAACATCATCCTTGCGGAACAGAAATTGC
CTGTTCAGGTTGGAAATATCTATGGTATCTGCCGGTGGTTGAGAAAATGTCAGGTCACGTCAAATCGGATTGGAGATATTCCTGTGTCTTTGAAGATCCA
AGCAGGTATCTTTTTATGAAAGGCTCCCTGCTTACCCATGTCGATAACATGTATGTTTTTAAAGCCTGTCAAGGCCAGGTTCTTCAAAATCTCACATCCA
AGTCCGCCAGCACCTCTGGGAAGTGAGGGTGAGTTTCCGGTCCAATTACTCGAATTTGCCAAGAAGGTGATGGTCGTACATTACCCTGGAAAGAGTTAGT
CCATCAATGCTACAGATCCGGGGTAAGAAGACACCAGAATATGGCCTACGTACAGAACAGACATCTTTTCCATGCTTGAAACACAGCTATCCGGGTCAAA
GCTGTCCATGTCAGTGAAAGAACCTGGTTTGGTCCTTATTCTGTCCAGATAATGCCTGACAATCAAATGTGTCAGTGTTTACATGCAAGAAATACACAGT
GTTCGATTGGTAGGTTACGTGAATACCATCGTTGTGAGCTTGTATCGACACCGGCAATCATCTCTGTGTCCGCCGCCATTTTGCCCGTCTTCTATGTGGA
AAAGACGGTGACCCGCGTAGATATATTATTGATCAACAAGAGAGCAATTTAAGTACCAAATCAGGTTGTAGTCTCTTGATCTTGCTGTGTTAAGATGACC
GTAGAGTATGGATTGGGACCTTTAGGTGGTGAGATGACCAAGAATAGCTGGCTCTTAAGAGAGTGGAGGTGAAGTCACTGGAGGTATCCCGGCGTGCTTC
CCCGCCACAAGGCGGCAGCTGCTAACCCCTGTACAGCGAATACTATGTACGTCTCTTATCGATAAAGCCGTAGGCCTGTACCCCATGGGTTCAGCGGACT
GCAGAGCCGCTAAATGCATCTGCCTACAGTACAGGCACTATCACCCATGAGTTCGTCCAATTATCTACCTCACAAATGGCTGCTCGCGGTGCTCAAATCC
TGGTCAGCTGCACTGTGAAGTTACCAAAAGCAGAAGCCTGGATGGAATCTGCTGTCGGCTCGCAATTTCAATGAGAAATTACATGCAAATTGACGCCGCA
CATCTGAAGCGCATTTCGCTATCCACCGGGGGAAGATGTCGCACTGAGTTCTAGTTTCTTCCATGCACCAAGTTTGAGTTCGCGCAAAGCAACTCTTAAT
TTCCAATATGGACGATTTACTCACACCAGTGAGCCAAGTGTATACTTCAAACAAAGATAAACAGCCACTTTTACAAGAAGTCACTTCCAGCTCCCGGCTC
ATCAAGAACAAATCTAGTGCTACAGGGTCTAGCTTGTCGAGCTACGAGGATGCCTTGGAAGCTCTCAAGGCCGAGCCGGACTATGATACCCTTTCTTCCG
TCCTCGATTTTCTTCTCAACGGACACACCACCAAAACACAAGGCGCACCCTGCAGTGTTCATCAACCAAATCCCCTGAACTCGCAGATCATACAGACGCT
AGTCACCGGAATTGTACCGAATTACTGGCAGTCATTAAAAGACGAGGCTGCTAAGGAAAATCAAAATCTTTCTCAGTCACAAACCAAACAGGCCCCTTTA
CTGCAGAGACTGCTGAGCTGTCTTCTCAACTTGACTGGGGTCAACGTCATCTTGACTCACCTGAGAGGAATTGTTGGTGAGCTAGGAACCAGCACGGACG
AGACTCAGAGGTCGATGATGAGCTTGAATATAGCCACTCTGCTCGATCTGCTTTGTTCGCTTCTGCATGGACACGGCGCCTTGCACCGAATTTGGACCAA
CAGCTCCCGAACTCTTGGCAGTGAATCCATGCTTCGACCATTAACTCAGGAGTTTGTCAACGTAACTGGCGGCGGCAGAATTGTCTCATTGGCAGCAGAA
GCAGAAAGATCTGCCCGAAAAACCTCAGGTGAAACTAATGCATGGGTTGCCAGTAGTAAAGACTACAGTAAATGGCTGGTACGGAACATCGTTAACTGGG
CTCGGGAAGATTCTTTGGAATCGCCTGGAAACCCGGTCTCTCAGCTACTCACCAAAGCTCTCCAGCTAGGTCATACCGGTATGATATATCTGATAGCCTC
GAACCCACAGTCCAAAGTTATTTGGAGACCACAAAAGCTGACCTTAATCTTGCAGACCTCTTGGTGGAATATCTTGTAGAGGGGCTGCTTTTAAGTGCAG
TCGAAAAGGATGTCGAGTTATTCGAAAAAATATTCGGCAACCTGCCTCAGCATGACCAAAAGCGCCTGCTGATGGCTATTCTGAAGTATGCCACCAATGT
TTTCAGCAGCCCGGAGAAATCTAAAGATGAAGCGTCTGTTGTATCTGCAGTAGCAGGACTTCTTCGAACAATTGTCAAAGTGGACGAAAAGAGAAGGGGT
ATTTTAGTGGGATGGCTGACCTCCGTTTCTGGCGGTGCTGCGGGCGAACATGTGGGCATCCGGCGTGCTGCTGTTGGCGTTTTGACAGAATACCGAGACG
ACATTACCATTGTGCTAGAAAAGACCATGGCTTTATTTGGCGATAATCTGTACATCAAGCATGCGCCACTGCTGCAGCAAGAAGGTAAGCTCCCCGGCTC
TTTGATCTCATCATAGGAACAGAACTAAATCTCTCTCCTGCAGCACATGCGCAGATACTGCTACTTAGCGCTGGCTATGTTCACCGTCTGAACCCTGTCA
AGCTTGCTATCCTAGTTAAATCTGGCGTCTATCTCAACGCTGTCTCGAGTAGGCTGAGTGCTCCTCAGACAAGGGCCCGCGTTCTGGGAATGATTGTGGG
CGAAGCACTCTCTGCCCTCACACAGGGTAGCGGGAAGGCTCTCAACTTCGACATGGAAATATTGAAGACCGACGAGGCAAAATGGTATAAAAGCTTGGTC
GAAGTGGCTGACACGGCTGGCTCTTTGGAACCATTGCGCCAACGCGTCAAAGTTGAACTTCCAGAATCCAAGGTTGGGACTCAGACTCAGAGGCCAGCCG
AATTTGTGAAGCCGCCGAAGAAGACCATACCAAAACCAGCTCATCGGGCTACCGGCTTTGTGATTGAGGAGGTCAGCGAAAGCGAAGAAGAGGATGATAA
TCTCGTTCCATACGCCAAGCCTGACTCCGATCGGGAAGACTCTGATGATGATGCAGAGCTAGTGAGCAGGAACAAACCAAGAGCTCCTGTCTATATCAGG
GACTTGATAACATATCTCAGAGACTCAGAGAATTACGACAAACAGGAGCTCTCTTTGACTACAGCGCCTGTGTTGATTCGACGCAAAGCCAACTACGGTA
CCGAAGTCGTAGATCATGCGGAGGAGCTGGCAGGGCTGCTGGTGGGAATACAAGACAAGTTCAACCTGGACGACTTTGAGTCTTTGAGAGTCCAAGGAAT
GGTTTCCATCATAGTAGCACAGCCGCGGAAGATGGGTCCTTGGTTTGCAAAGACATTCTTCGATGGCGACTACAGTCTTTCGCAGCGTGCTTCTGTCCTG
ACTGTGCTGGGACTTGCAGCAAGGGAAATAGCAGGCTTTGAGCAGTCTGAATTTGCAGATTCTGCATATTTCCCGTCCAAGAAACTCCCCGAAAAGGTAG
AGCAGTTCTACCTGGCGCAAACCGGACAAAATCAAGTTGCCGGGGGTTCAAATCTCAAGTCGCTGCCCCCAAGTGCCATAGACAGTATTGCACAATCGAT
AACATCAGGCTTCCTGGCACCAATGGTGGCAAACGCGGCAGATGAGCAGACAGGCCCTGATTTGCTCAAGCTCTCGTCTTTCGCATCCCGGTTGCAGCAG
AGGCAAGGTTCTGGCAACTCACCATTGCAGAAGGGCCAAAAGAAGGCAGGCGTTCGCGCGATCCCAAATACCACGGCCCAGCTGATATCCGCATCGTTCT
TCTTCCCCCTGACTGCACGCTTCCAGGCCGCGCTGAGCTCGTCGACGTCTCGGGCTAGGACTATTGTCCTACAACCTGAGCTTCTCACCCACCTACTCCG
CACCCTGGGTATCCTGGTGCACGCCGCTGGCCCATCAACGCTGTCCCTGCCAGACATGACGGCCGAGCTCTGGGGTCTGCTACTCGGCAGTGCAGTACGG
GCTCGATGCGCGGGAGACCTAGGTGTGACGCGCGCGGCGCTCTTCGCGCTGCTGGCACTGCTTGAGGTCAACGGGAACGAGGAGGTACGCATGCGTGACA
TTTGTCGGGAGCTAGCACGCGAGGTGGTTGAGACGCAGGAATGGGTGTCGCAGGTCTTTGAGAACACGCGCGGTGGCGATGGGGAAGGCGGCGAGGAGAA
CGAGGTCAAGCTGTTGGCTGCCGGGGTGCTCATTCGGCTCAGGGATGCCATGGAGAGGTTCCGGGCCTTCTTGATTGGAGACATGATTGGGTGATATTTG
ACTGTGTGTCTTAGCGTCTGCACTCAGAAAGTACTTTTGTGTTGAACCCCCAAGTTGACAATTATAAAGCTCAAGTTACTCCTCCGGTTCAGGGGTTCAC
CGACCCTTCTTCCTACCTACCCTGCACTTGACAATCGAAGACTACGGAGTGGGCCATGACGGAAGAGCGACCCATAAAAAAGTCCAGAGGTAGGTCGGCG
CAATGGAACGATTGCGACGCCATGATTTCAAATCAACGAGAACATCAACTACACACATTCTTTCACACAACAAACCGTGACAATGGGACAGCAAGCTTCA
GTACCAACAAAAATGCGTGAGTGTAAGGCCTGAGATTGCATATCAAGGTGGCTTTTGGACCCTAGAACTGACACATACATGCGCATGCAGCTGCAACCAC
CGCGCCGGCGCAAACCGCCAATGCAGCCGACGCCAACAAGCCCAAG
GTGCGATTTTTTTTTTTTTTTTTTTTGCGAACTTGCTCTCTCGAGAATCGAAGG
GTTGATCTGCGCTAACAACTTGCATCAATTAG
CCCTGCTGTGTTTGCAAAGATGAAAAGGCAGCTCGCGACGAGTGCATGCTTTTCTCCAACGCCAAGGA
CCCAGCCGAGGATTGCAAGACAAAGATAGAACAGTACAAGAGCTGCATGGCGGGCTTTGGATTCAAGGTCTGA
AATGGGCCCTTTGCGCACCTAGAAATC
GGTCGGGCGATCGAGGGGCATAGACTGTACTATACGAACGAGGGGCCACTAGAGCCGACCCAGTGTACCAACAAACTACCTGTATCGAACGAACGGCTAA
GACATGATAGACACGGCGTTTTTGTTTAGAAACTTTTGAACTCTAGAGGAGAGGCTAGCACTGCCTCCATGCACTTTCACAGTCCTCCAAATGCTTAGAC
GGCTGAGTTAGTGTCGAAACTATATGGTCTACATATACACCAGTCAATTGTTTTGTGCACTGCGGCCATCTTGTACATCCTGACCAAATCCAGGGGAAAT
CACTAACAGCCTCGTCCGCCGAACTAACATGCTCAGGGGCCGGCTACAGAGAACAAAGGTTTCTGGTTCATCCTCTCAAACCCCTGTTTTCCACCGGGTC
GTTTTACAACATTCTCCTTGGAGATACAGCTTGAGCATGAAGGCCCCCAAAGCTCACGGCATAGCGGCCGCCTTACTTCTGTACTCTTTGGGTTCCTCGT
CACCGGTCTCTGGGTGCGTGATGCAGATATCCGGCAACTCTGCGGCTCTCTTCTCCACTACGTTGTAGCCGGCCTCGAAGTAACGCCGAAGGCTACCCAA
CTCTCGTTCCAGACCCGTCAACTTGGTGGCGATTGTTGACTGGGTCGTTTGTCTTTGATGCAGCAGCTCCACTAGCCTGCTTAGGTCCTTTCCTCGGGCT
TGGTTGCTTGAAAGCAAGAAAACAAAGGGTCAGCTGAGTGCGTTGGCCTTGTGGCAGTTACAATATTGGGGTCCATACACTTTGGTGCTCAGGGCAGTGA
TGCGGCCTTTGGCTCTCTTTTTGACGCCGTCTACTTTGGTCAAGTAGTCGGTGCGGATCTTCTCAACTCGCTCATCAAGACGTTTCTGGATCTGCAGGCG
AGTGTCAGATCCGGGTGTAGCAGACTGGGTTAGGCGTCACCGACTTGAATTGCTTTGAGATCCGGCGCCACTGCGGATGAGTCTTCAGGCTTGTCATCAG
AGGGCGGACCTCGGATTCTGAGGGGTTGTCTCTTTGGAGGCATGACGATCCAAACGGAAGCCAACGGAAAGCTGGCTGTCGTGTCACTGAAAAGATTTTG
GCGTGGTTGTCAGGTTGATCTCCTAGTCCTTGTGATAGCGCCGTAAGAGTGAAGGCTGTTACAATGATTGATTTGAGCCAGAATCATACCGTTTCTTGTA
TAACGGAACGTTTTTCAAGTAACTCTCGCTATCTATGTGCGCAATTGGACATTTCTAGCTGCTGAAAACCTACGCCTTCCCATTTTGGTTTGCTGGACTT
TTGCGGACCATATGGCATGCTTAAACAGGAAGGGGCTCCTATCTAAGAAACTGCATTCCCCTCAATGGACACAAACCTGCAGTATTAGCCCGGCCTCTAC
AGCCCTCCAAGGCACATCTCCAGGCCAATACTAGCGGGATTCTCTCTGCGAATATATAATTCGACTACCAAGTGGACTGTATTGTTTCGCCGAAGTTCAA
CGACGGTATCTCGCCATTAGTGCTCAGGGTAGCAATATGGACCTATATTCTGTGTGGAATATGCGTGCTACAACTAAGTGCGTAAGCACCTTCCTAGCGA
CCAGCTACCTTGTCTAAGGCACGTATGCATTAAATACCTTATATTGGAGGATGTAGCGACTTCTTATTGTCGAGGGTCAAGTGCATCTATCGGATATGTC
CGTCTACCAGGGTTAGGGTTGAAGCATTCCTGGGCTCACTCATTAACTATTCTAGATAAGATAAGACAATTAATGTCCAGGGTTTGCCCCGCCAAAATTT
TCTCAGGTCGGAGTTCCCTTCAACGACGTGATCCGCGCATTAGTCCCATCCCCAGATACCAAGATCCAGCTGCCGGACCGTCCTCGTTCGGCATTCCACA
ATGGGTCTCGCTGCCCCAAAGAAGTGAGTGGCCCAGTCGCCGACTTTGCGCCTCCAGAACTGACATTAACCAACAGCAAGCGCAAGCTTGGCAACGACCC
GAACAACACGAGATGGAGCCGTAACACCGAAAACTTTGGGCACCGCATGCTTCGGTCCCAGGGCTGGGAGCCCGGCCAATACCTAGGACCACAAGATGCC
TCCCACGCCGTCTACCACACGGCAGCCAGCGCTTCGCACATCAAGGTCGCGCTCAAGGAGGACAACCTTGGACTGGGCGCCAAGATGAACCGCGGTGACG
AGTGCACCGGCCTCAACGCCTTCAAGGAGATGCTGGCGAGGCTGAACGGCAAGTCGGAGGCCGCGATCGAGAAGGATAAGAAGGCCAGGGAGGCACATGC
CATGAATGTTTATGTGGAGCGCAAATTCGGGACGATGCGCTTCGTGAGCGGCGGCTTTCTCGTCGGCGACGTTATCCAAGAGAAGAAGGAGGATGCCGAG
GCGGAGAGCACAGATGGGACACCAGAGCCTGCAGAGGCGACCGTGAAGAAGGAGAAGAAACGCAAGGCTGGGCGAGACGATGATGATGAAGCACAATCCA
AGGAGGAGCGTCGGAGAGCCAAAAAGCAGAAGAAGTCCATGAAAGAGACGGGTTCTGGCGGCGACGACGTTACATCCGAAGAGGACTCGGCAAAATCCAA
GAGTAAAAAGAGCCACAAGAGCAAAAAGGAGAAGAAGCGAAGGAAAGAAGAGCCGGCTTCTGACGAGCAGGAATCCGAGGATGAGGAGAGCCGCGAGAAG
CGGAGAAAGAAGGAAAAGAAAGAACGCAAAGAGAGGAGAAGGGAGAAACGGGAAAAGAAGTTGAAAAAGAAGCAGCAGCGCGAAGAGGACAGTTCATCAT
CGGAGGCTAACTCGGACGACGAGACCACCGGGGTCGATACCGGCGCGTCTACGCCCGTTGCCAGTGGTACATCAACTCCTGTCTCTCAAGTCTCGGTTCG
TCACCTTGCCAGGAGACGCTTTATTGCCCAAAAGCGGATGGCTATGAAAGATCAACAAGCACTGAATCAGGTAAGACACAATTCCTTCGAAAGTAAGCCT
CAAGGCCGCGACGCTAACATTTTTGAAGATATTCATGATAAAATCGTCCTAAAGATTACTAGCCAGCGACAGTTATTCCCCATACAAATAAATATCCTAA
CATTATGACCTTTGACCTGCAAAGATTTGTTTTTTCACGTCCGTGACACCCCCCGAACATCTCGATTCCTGGTACAGTCTCGTTCGATTGAATTGACACT
AGAGAGAAATTGTTGTTTTTTAAAGTCACGGCAAAGCCATACGGTGACTTGACATGCAGTCGTAAGAGAGCATCTGTTCTGCTGGGCAATCACCGCTGCT
AACCCTGGCAGGCAACTCCAGGGTTGATTGCACGCAGTATAAATTTGTAAGAACATGAGATGCAGATGCGCCTCGCTACTCAGCACCCCTCATCAGAATA
GGTTGAGCCTGGCGCAAGCGAAAGGAGACCGACTGCCTGACTTCGTTTCAGGAACAACCTCCCGTCGACTGTAGCCCACCGAGTTATCGTCACTTATATA
TTAGTATAAGATATCGTTGGTAGGCTCAAGCATTTGCCTCACACAGCTTCGGGGTGACATCAAAACTCTCCGAGAGGTCCCTCCCTCGAGTTTGCCAATT
ATGGACGAACAAGTATTTCGAGCGGATTCCCTTTCTGGGAATACATATGAAATCGACACTGAGGCACATGTGCAAGGCGAGACCGAAGGGTTGCAGTCTG
TAGAGGTGAACGAACCTGTAAGCATTTTGCCAAGGCCCAGCCGGAAAAATTAAACCATTTCCCCATTGAATAGTCGTTGAGCTTGGGGGCTTGTCTGATC
ATGGATTCGAGCCAGTGTTGTGCGACCGTGAGAATGATGGTGGCCAAGCTCAAGGGGAAGAACCCAAAAAGACAGCACTGGCACAGAGAGAAATATATCG
TCGTGGTCATAGCAGGAGGGGAAGCAAAAGCCGGAGCATGGACCGAAGTTGAGACCGATACCTTCCAAGGTCCGTGTCAACGTCTTCAAGCCAAGTCTCC
AGTCATTCATCAGGCAATAACCTGTACCAGGATTACCGCGAGTTGTTCTCCAGTTCAGCGTTCAATACTGCCCCTTGGAACTCTCCTCCAGTCCCATTCA
GCTTAGACAGCGAGGATACAGAGACTCATACACAGCAGCTGCGAACCAACGAGGTCTTGATGGGAGCGAGGAACAGCCCTGCGATCGAGATATATGATCC
CAAGTATACTGGGAATGATCTGTTCCAAGGGCCTCGCCATTCTAAGCTTACAACATTTCAAGATCCAGAGAAGCAGGAACGGCATCTGTTTCGTGGACTA
TGAGTCCACACATGACCGCGATAATTCTAATCCGAGAGCAGGAGACTGTGACACGCTTGAAAAGGCATCTTTGGCAAGATATCTTGAATTTTGAGAGCCT
TCAGGTTGGTGCTATTGCTCCCTGGTTGCCACCTCCGTGAATCTGCGCCTCGCTTCGCGTTTTGTCTGCAAGAGCTAATTTGCTCGGCTATAGACATGCT
GGTCAAGTTCCACTGCTACGTTCTAATGACCGGCTCAATCTCATCACTTTGCTAGAAGATGTGAAGCAAACATTTGGTTATGGCCCAAACTTGCTGTGAA
TGGCAACCATGTCTCGTTCATGGAACCAGGTCATCACAAGATATCTTATACAAAGTATTCGGGTCTAGTCTAGGAGCAAGTGCGGATCCTACCTTATATC
CTAACCAGTCCTTGATGCAAGCTCAACACAGCCAGATGGTCGTGACCATGATATACAACAGGCTATCTGCCTTCGTATTCGCCAATCGGGGTGTGTTGTT
GTGCATGACTGTGAGTCAATGTCCTTATTGTACAGACCGAAGCAAACATGCCCCTAATCACTAAGATCTATCTTCGAATCCCCAGTATGCCTCATAACCT
GTGGGGAGATGAGTTTGAAAGAAGGACATGGAAAAGCTATTACGCTTGTTAGTGAACCTCTCAGAGAATTATCCAGGCCAATGCCTTTTGACCCCGTATC
TTATGCCGAGTCTACATGGTCTCTGCCTCTTGACGATTGCCAGAGCTGGTCTGTGGGTTAGATCCGATGCTTCTAGGAAGTACTTCAAGTGCTGCTAAGC
ACTAAGCTGTATGCATCCAGCCGAGGTCATTCAGCGCTTCTATTTACCTATTAGGAAGCGAATCACCCACTGCAGCAAAGTTTCTGGGGCTATCCATCGG
ATTTTGGGAGTAAGCTACCAGCTGCTAATGTTATATGTATCAAGAGAAAGCCCTTCGTCTCAGCTGTGGTGCTCACCAGTACATTATAGGCCTACAATGA
GAAGTCGCCATGCAGACCGAGTCTTCGTCAAGAGCTTAGGTCCCTCATCCAGCCCATCCAAGCTTTTGTGAGTATGATATCGCGTTCTCAAATAAGTTGA
TCCGGGGTCTACAGCGTCTTTATACCGAGGCAACTGCCTCGGTCGTGGTTACATGTTGTTACGAGTCGCGTTTACTTTTTCAAGCGATTCGCAAAGGGGA
GAGTCCCATATTTTTGCTGCGAGCGACCTGGTCGGTGAAGGAATTAGGGAGGCCGTTGATCAACTTCCCGAACCAGACAGTTTGCTTGGGAAAGCCGTCG
TGCTGCTATCAGACCTCGCCGCTGTCTTCAACTTGACCCTATTGAGCGATGCAGGGCATAGCCAGGTTGACATCAGGAAGATGTAACTACGAATGCATTC
AAAAGCTGGTATGCTATGTTTATAAGTCGGTTCAAAAACTTTCGAATATCTTCCGCTAAAAGCATTTGTTTGATTGACATAGGATTCAGACATCAACACC
AAGCCATCAGCTCGTCGTCTGTTGCAAACGGCCAGCCTATTGAAAAATGAACCCCTGGTTGTCCACGGTGTCGTGGAAACACAAGCGCGAGTGATTCGGG
GGCTTGCCTCCACATCTCAATCATCGGATTCCTCGGGTGCTCGGGCAAGATGTGTAGGCTGTGGAGGTTACTATGGAAAGCCTACGTATCGTCTTGCCTG
ATACCAGGGACACCGGACGGCAAGAATAGCATCTTACGGTAGAGATCAGCAGATTGTTGAGGAATTAGAAGACACCTCGAACGAGCGGTTGATCGTTCAG
ACCAGCTCAGGTCGTTCAGTCACACAAACAAATGGCAATTCGGACCGAAAAGGTGGTTCGTTGAGGATATCAAACAGATATCATCACGCGATCCTCACAA
TTGGTGAGACATGTCGAGGCTTGGAGAAAAAAAAAACTGTGTGTATACTTTGAGCAACCTTCATCTTGATCCGCTATACTACTGGGATTTCCACAGGCTG
ACATCACCTGTTTTGCCCAAACTGGTATATTTTCCGACCGTCCAAGCATTGGTGGGCTGTAGATCGAGGCCGAGATCAACCTAGCCAAATACCATCAAGA
ACTAGCAATATATGCATTCACTATCGTCACCGTCGTTTTCCTACCACTTTCTACTATAGCATCCGTCTTTGGAATGAACATGGCAGATATCCGCGAGATG
GAAGTAGGACAATGGCTATATTGGACGATAGCGCTTCCGGTTACAGCTTTGGTGATCCTGCTTGGTCTCTGGTGGATGGGAGAACTCGATAACGTTCTCA
AGCTATCTGGGAGGGGGCAAAGCGTGATGACAGTCAAGGAAGACATGGCAACTCCCAAATTCGCGCCCTTTCCAGTGAGGTATCCTGTTCTTCCAGGCGT
GGAGAACGTTACGGGCCGACTGCTTCCCCCCATCGCCCAGGAGTGGGCCTTACACGTCGCCGCCGCCGCCGCCGCCATCAGGAGTAGCATTTCCACCAGT
TCCGTTGTCAGGACATCTTGGAAGACGAAAAACATGGGCTTGTCATGCAACAGGCGGCTGAGGCGAGTCTTACGATGCCCCCTGGATTCCATGAATTTGA
CCGAACTCTTATATCTAGGGTTTCACTGTATATCCAAGCGCTGTTGAGTGCCATGTTATAATATCTTGCAACCGGGAACAGAGTTTAATGTGATGGCTGT
CAGGAGAATTATTAGAGTGGCCAATAGTGGTTGTGTCATTTGAGCAGCAAGAGTGCATTTGGAAGACCTATGCGGAATGTCCGGTTTATACAATGGGTGA
CGTCCCTGTGATGATACCTTGCATACCCGCTGTTTATGTAGCGTTGGCTCGAACTACTTACTGTACTTACTGGATCAAGGAGATATAGTCGCGAGTCAGG
ACTGCGCCCTACCTGGAACGATCTACAATCCAAAAGCGGGAGCTACTACGTAGCACTATGGTATATGCGTAAAAAAAAGTTGAAAACAGGTCTGGGGCAC
TGCGAGAAAAAAGAAAAGAAAAAAGGGTCCTCCAACAAGATATCGGCTGGCAGAAAGCATGATCCCATCCAGCCCATCCATGTCTTGCCTCCCCGCTTGC
CCCCTCCCCCTCCTCTTGCGTAGATGCTTTGCTTCTTTTGACCATGGGGAAGCAAAACTGTGGCAACCGGGACCTGCCATCCGTCCAGTGGTAAACACCA
GGCCACCTACTGTACGGAGCACACCTTATGCAGGAGGTTTTGGAAGGAGGAAAAAGAATTGAAAGTCCGCCAGGGTCTAGAACTTGCAGAGGACCATGCC
GGAGTACGTGTCTGTTCATGTTGGGTGGTGCCTGCAGCTTCTACGGCCGTCCGAAAAAACTCCGCCCGATATGTGCATGATTTTTGGGGGAAGAGGGCGT
TTTGTTTACGTCTAGTTCTAGTCTAGAACTAGAACTGCAGTAGTGCTAGTTCCCCCCATTGCCAAGGCTCAACTGCGATTATATTCCGTAGCGCAGTGGA
ATTTAGTATGGTACTACGGTATGGGACATGCAGATGAGGCGGGTATCCAAGATTCAGCCTATTATTATTATTATTATTATTATTATTAGTATTTTGGCGT
GTATCCCCTTAATAACAGTAGTATACAAGCACAATAAAATAGACCAGCCCATCCTAATGCAAATATGTGCCCATTTCCTTGCCTGGCTGGTGCGGGGCTG
TTGGAGGATGGGGTGGTTTTTTTTTTCTCTCCCATCATAAGGTGCCCAAGAAAGCCAAGGCAGGTTACAGATGAGACGAGCAATTGGTTGGATTTCAGCT
CATGTGGTGCCTGTTGTCACCCAGCAAACCAGGCTGTCTCTGGTTTGGAGTGTCACCTGAAAATCCAAAAAAAAAGTTACTTTGCGGTTTTTAGGGGCCT
TTGGGTTTTCCTTTTGTGGATTAAAAGAATAACAGAGGGGGTGGAGGACATTAGAAGAAGAAGAGGGAAAAAAAAAAAAGAAAAAAGAAAAAACATTGGC
ATAAATTGTTTGGTTGATGATAAAGTTTTGAACTCTTCTCCAGGTGAGGAACAAATAAAGCGAAAAGTCCCGGGGTCAAGGTTTAATACTAGGATGGAGG
CGCTGTTGGACCGGTATACTACTGTACAATACATAGTATGTACCAATGAAGATGGGGAGCGGGCAACGCAACACGACATGAGCCCATGGCGAGGTAGCAC
TAAAAACCGCCCACTCAACTGCAACAAGAGTAGGCCAGGTAGAGATACGAAGTAGATGCAGTAAATAGTAGCATTGTTTCTGGTATCACTTATCACACCA
TCAGACTCGAGATATGCAGCGCAACCCTCCCCACCCTCCGTGGTACGCGCAATCTTTCAGTGCGTCCGTTGCTGACTCGCCAATCAATCAAGCAAGACGC
AACGCAACCAACAAACAGTTCAAGACGGAGCTCCGCGGCTATGGTGCCCGGGTGCGGGGGAGTCATCGAGATAATGTTCGACCAAGGCGGTCCTTTCTTT
ATCATGCATTTCATTTTTCGCCCTTGTTGTTTGCCGCTTTTTCTCTCCTCCCAAGGCATCCTTGGCCTCTATACTTTCTGCTTGGAAAACACACTATTGT
ACAAAGTATAGTAGCGTTGCCGGCTATTGTCCACGATGCCCAGATCGAAGCTTGAATAATTAGGCAGTTATCTGATTCGTTTTTTTTTCTCCCACGGCGG
GCTAGGAGCGAACTATTCCACACAGAGTAGTTCAAGATGCGAGATACTTAGATACTAATTCAGGTAGGTCCAACTCTCTGGTTTTGGCTACTGGCGCTAG
GAGGCAACTACGACACCGCTTTTTGTTGAGTGCTTGCGTGTGTGTGGCTTGGTTGTTTTGGTGTTTATTTCTGTCTGTTCTGAAGCCTTCAGCCATCATA
TGGGTTGGGTTTAGAAAAAAAAAAAAAAAAAAAAAAAAACCCCTAAAATAAAAGAGGCAACGATTAAAAAAAAACAATTACCACAAAAAGAATAAAAGGG
ACTAACGCCCTGCAAGCCCAGTAGCCACAAAGATCACGCCTCCAACCGGAAGCCAACGGATGGAAACCTAGACTGGCGCAAAAAAGCAACAAGGCCGTCG
TCCACCCGGCAGTCTCCAGGCACAAACATCAAGGCACAGATGAAGATCTGCAACCTCTCTCTTGGCAAATTGTGGCTCCATGCCTCTTTGTGTTTCCACA
AGCTCCACCTATAGTGTAATAGTGGACTATTTTGCACATAAGAAGCTTTAGATCTTTCCTGGGGAAGCTGGTCTGCCGTTGCGCTTGTTCCTAGTTTTGC
TGCACTTCATCACCCAATCTTTGCCTCCCTTGTTCATTCTTGCGTCTTTATGGAGTTAGTTACTTTGCTGTTCTGTTTACCCCGCAAAAAGAGTCTCCCC
AAAAAGTGGACACGCAACCATACCAGTGTCCATTATTCACGGCAAACTGGCAAGAAGACACGCGCGAAAATTTAATTGATAACCATATTGGACTTTGCGG
Copyright 2006 Fungal Plant Pathology Lab. & FBL
E-mail : yonglee@snu.ac.kr
Magnaporthe oryzae ATMT Database