Home   Guide to ATMT Database   Sitemap   Contact  
Sequence ID  5330163
Locus Name  MGG_09214.5
Gene Name  
Protein Name  predicted protein
Species Name  Magnaporthe grisea [Magnaporthe oryzae 5 PROTEINS]
Protein Sequence
[916 aa]
+  1
101
201
301
401
501
601
701
801
901

MANNSDATTVTLDIVSPSVGVPAPLTFPDLPAHTTIAQLQDKIRMNLTLPNRNAVAMRLIYHGRMLAQPDMKLSDAFGADAFHTDNRRVLHVVLMVPAGTEPSPSTTSPTQPMATTTRDIIAQNQRERAARNSLGIQDQHPQLPTISQPAEPPSMTSTGSAARYTTSSFGSIPFPTGQASGSSSDTLWSETAQSMAENRAREQATRFLEQLQATRARQERINQLSSQLHGNAEQVHAARMNIQLSSQNPAAPIPHNQLSQQTSSQQNGAVQASAPEVYILNSPEGPYAVLLNNGGVYTSLPVGQPASLSTGTNSAETPTESLSNLVTAHFPVGGVQPASSQPFATNDFGATEDTDFLERWRQDGQRRQFELRQRYVQLRQQHERVQEQLALRRMQDARRVIPWARHPDPQGAAAIFQAIWPHLWLVIRLVLLMLWFTSGLGWSWTRWCGVVAVLLAIIVINSGLLNGRLENAWQPVRQHLERLLPLADHAQANAAGGAVPPAAAPGGANNRQGQVPPAADRQNARAAPDPREAAERMVAARREANANWLLDQVRRVERAGLLFLASIAPGVAERHIAHIEAEARAERQRREAAEAEAAAAAAAAAATATSDAAEAENLLETKLKSRVQGRKYPTTTFKANGRPVLAGVTLEGSIATGEGFGTRYSSAAHNGGGATRTKCPAPRRFQPYTRSHVESTPNLPRRDSDINRSTKGFLCRDPDSQRRLDERSTTKCNSLWDDGSKDSGSEKRRNVQKVKQSLTRRTNGTMPEMHVGTVHNISEATWMLGAGCQYSRGVTSSPESDTQELAGPVGQVSAILDNIQQWSAPINMGYRPAGVSTVMGSSAVESSDSQDSITTLEAVNHPVRPPLAGDLNGSTAGPSDTGPPVELTEALENDGIETDLIFSDWLNYPESEADGS
EPSPSTTSPTQPMATTTRDIIAQNQRERAARNSLGIQDQHPQLPTISQPAEPPSMTSTGSAARYTTSSFGSIPFPTGQASGSSSDTLWSETAQSMAENRA
REQATRFLEQLQATRARQERINQLSSQLHGNAEQVHAARMNIQLSSQNPAAPIPHNQLSQQTSSQQNGAVQASAPEVYILNSPEGPYAVLLNNGGVYTSL
PVGQPASLSTGTNSAETPTESLSNLVTAHFPVGGVQPASSQPFATNDFGATEDTDFLERWRQDGQRRQFELRQRYVQLRQQHERVQEQLALRRMQDARRV
IPWARHPDPQGAAAIFQAIWPHLWLVIRLVLLMLWFTSGLGWSWTRWCGVVAVLLAIIVINSGLLNGRLENAWQPVRQHLERLLPLADHAQANAAGGAVP
PAAAPGGANNRQGQVPPAADRQNARAAPDPREAAERMVAARREANANWLLDQVRRVERAGLLFLASIAPGVAERHIAHIEAEARAERQRREAAEAEAAAA
AAAAAATATSDAAEAENLLETKLKSRVQGRKYPTTTFKANGRPVLAGVTLEGSIATGEGFGTRYSSAAHNGGGATRTKCPAPRRFQPYTRSHVESTPNLP
RRDSDINRSTKGFLCRDPDSQRRLDERSTTKCNSLWDDGSKDSGSEKRRNVQKVKQSLTRRTNGTMPEMHVGTVHNISEATWMLGAGCQYSRGVTSSPES
DTQELAGPVGQVSAILDNIQQWSAPINMGYRPAGVSTVMGSSAVESSDSQDSITTLEAVNHPVRPPLAGDLNGSTAGPSDTGPPVELTEALENDGIETDL

DNA Sequence
[2751 bp]
+   1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
1801
1901
2001
2101
2201
2301
2401
2501
2601
2701
ATGGCCAACAATTCAGATGCCACCACCGTGACCCTCGACATCGTTTCGCCGTCCGTCGGTGTGCCCGCCCCGCTCACATTTCCGGACCTACCGGCGCACACAACCATTGCCCAGTTACAGGACAAGATTCGCATGAACTTAACACTGCCGAACCGCAATGCTGTTGCGATGAGGTTGATCTATCACGGGCGTATGCTGGCGCAGCCCGATATGAAGTTGTCAGATGCTTTCGGAGCAGATGCTTTTCACACTGATAACCGCCGCGTTCTACACGTCGTCCTGATGGTTCCTGCAGGAACGGAGCCGTCACCGTCGACAACATCTCCAACTCAACCTATGGCCACCACCACCCGCGATATTATTGCACAGAACCAGCGAGAGCGAGCAGCCCGGAATAGCCTCGGTATACAGGATCAGCACCCTCAGCTACCCACGATCTCGCAACCAGCAGAACCACCATCTATGACGAGTACGGGTAGCGCCGCACGGTATACAACATCAAGCTTTGGCAGTATCCCTTTCCCAACTGGGCAAGCATCTGGCAGCTCCAGTGATACGTTGTGGAGTGAGACTGCGCAAAGCATGGCAGAGAACCGAGCCAGGGAACAAGCAACTAGGTTCCTAGAACAACTGCAGGCAACCCGCGCCCGGCAGGAACGGATCAATCAGCTTAGCTCACAACTCCATGGCAACGCCGAACAGGTGCACGCAGCCCGAATGAACATTCAGCTCAGCTCGCAAAACCCGGCGGCTCCGATCCCCCACAATCAATTGTCACAGCAAACCTCCAGCCAGCAGAATGGCGCTGTTCAGGCATCTGCACCTGAAGTGTATATCTTGAACTCTCCGGAAGGTCCATATGCCGTCCTTCTCAACAACGGTGGCGTTTATACCTCGTTACCAGTTGGGCAGCCTGCGAGTCTTAGCACAGGGACGAACTCGGCTGAAACGCCGACAGAATCCCTTTCAAATCTGGTCACGGCCCACTTCCCGGTCGGTGGTGTCCAACCTGCCAGCAGTCAGCCATTCGCCACGAACGACTTTGGAGCAACAGAAGACACTGACTTTTTGGAGCGGTGGCGGCAAGATGGTCAACGACGGCAATTTGAGCTTAGGCAAAGATATGTACAGCTCAGGCAGCAGCATGAGCGAGTTCAAGAGCAACTTGCCTTGCGGCGCATGCAGGATGCTCGTCGAGTAATTCCATGGGCACGCCATCCCGACCCCCAAGGAGCAGCGGCTATTTTCCAGGCCATATGGCCCCATCTGTGGTTGGTGATACGTCTAGTGCTGCTTATGTTATGGTTTACAAGCGGTTTGGGTTGGTCATGGACGCGCTGGTGTGGTGTCGTCGCGGTTCTTTTAGCTATCATCGTCATAAACTCTGGCTTGCTCAACGGTCGGCTAGAGAATGCATGGCAGCCAGTTCGGCAGCATTTGGAACGCCTCCTCCCATTAGCTGACCATGCCCAGGCAAATGCGGCAGGAGGTGCGGTCCCACCAGCTGCAGCGCCCGGTGGTGCAAATAACCGCCAAGGGCAGGTGCCTCCTGCTGCGGATCGTCAGAACGCACGAGCTGCGCCGGATCCCCGCGAGGCTGCTGAGAGAATGGTGGCCGCTCGAAGGGAGGCGAACGCCAACTGGCTGCTCGATCAGGTTCGGCGTGTGGAGCGGGCTGGTCTTCTCTTTCTTGCCAGTATCGCCCCTGGTGTTGCTGAGCGCCATATTGCGCATATTGAAGCGGAGGCCAGGGCTGAACGTCAAAGGCGGGAAGCTGCTGAGGCAGAGGCCGCCGCCGCCGCTGCTGCTGCTGCTGCTACTGCTACTAGTGATGCCGCTGAAGCGGAAAACCTGCTGGAGACGAAGCTGAAGAGCAGGGTGCAAGGCAGGAAATACCCAACAACGACATTCAAGGCGAACGGACGTCCGGTTTTGGCCGGTGTTACCTTGGAGGGAAGCATAGCTACTGGTGAGGGTTTCGGTACCAGATACTCATCTGCTGCCCATAATGGAGGTGGTGCAACCAGGACAAAATGTCCCGCGCCTAGACGGTTCCAACCGTATACGAGATCACATGTAGAATCCACACCCAACTTGCCTCGCCGTGATAGTGATATCAACAGATCGACGAAGGGTTTCCTTTGTCGCGATCCAGACAGCCAACGGAGACTTGACGAGAGGTCGACAACTAAGTGCAACAGCTTGTGGGATGACGGGTCGAAAGATTCAGGGTCGGAAAAGAGACGAAATGTGCAAAAGGTAAAGCAATCTTTGACAAGGAGAACAAATGGAACTATGCCTGAAATGCATGTTGGCACTGTTCACAACATCAGCGAGGCCACATGGATGTTGGGTGCTGGTTGTCAGTACTCTCGTGGCGTGACCAGCAGTCCAGAGTCTGACACGCAAGAGCTAGCTGGTCCTGTGGGACAAGTTTCAGCAATCCTCGATAACATTCAGCAGTGGTCAGCACCCATCAACATGGGATACCGACCTGCTGGTGTTTCGACAGTCATGGGCTCCTCTGCCGTGGAGTCCTCAGACTCGCAGGATTCAATCACGACTCTAGAGGCGGTTAATCATCCGGTCAGACCTCCCTTGGCAGGAGACTTAAATGGCTCTACGGCTGGCCCTTCAGACACTGGGCCACCAGTTGAACTGACTGAAGCCTTGGAAAACGATGGCATTGAGACTGACTTGATCTTTTCCGATTGGTTGAACTATCCAGAGAGCGAAGCGGACGGCAGCTAG
CAACCATTGCCCAGTTACAGGACAAGATTCGCATGAACTTAACACTGCCGAACCGCAATGCTGTTGCGATGAGGTTGATCTATCACGGGCGTATGCTGGC
GCAGCCCGATATGAAGTTGTCAGATGCTTTCGGAGCAGATGCTTTTCACACTGATAACCGCCGCGTTCTACACGTCGTCCTGATGGTTCCTGCAGGAACG
GAGCCGTCACCGTCGACAACATCTCCAACTCAACCTATGGCCACCACCACCCGCGATATTATTGCACAGAACCAGCGAGAGCGAGCAGCCCGGAATAGCC
TCGGTATACAGGATCAGCACCCTCAGCTACCCACGATCTCGCAACCAGCAGAACCACCATCTATGACGAGTACGGGTAGCGCCGCACGGTATACAACATC
AAGCTTTGGCAGTATCCCTTTCCCAACTGGGCAAGCATCTGGCAGCTCCAGTGATACGTTGTGGAGTGAGACTGCGCAAAGCATGGCAGAGAACCGAGCC
AGGGAACAAGCAACTAGGTTCCTAGAACAACTGCAGGCAACCCGCGCCCGGCAGGAACGGATCAATCAGCTTAGCTCACAACTCCATGGCAACGCCGAAC
AGGTGCACGCAGCCCGAATGAACATTCAGCTCAGCTCGCAAAACCCGGCGGCTCCGATCCCCCACAATCAATTGTCACAGCAAACCTCCAGCCAGCAGAA
TGGCGCTGTTCAGGCATCTGCACCTGAAGTGTATATCTTGAACTCTCCGGAAGGTCCATATGCCGTCCTTCTCAACAACGGTGGCGTTTATACCTCGTTA
CCAGTTGGGCAGCCTGCGAGTCTTAGCACAGGGACGAACTCGGCTGAAACGCCGACAGAATCCCTTTCAAATCTGGTCACGGCCCACTTCCCGGTCGGTG
GTGTCCAACCTGCCAGCAGTCAGCCATTCGCCACGAACGACTTTGGAGCAACAGAAGACACTGACTTTTTGGAGCGGTGGCGGCAAGATGGTCAACGACG
GCAATTTGAGCTTAGGCAAAGATATGTACAGCTCAGGCAGCAGCATGAGCGAGTTCAAGAGCAACTTGCCTTGCGGCGCATGCAGGATGCTCGTCGAGTA
ATTCCATGGGCACGCCATCCCGACCCCCAAGGAGCAGCGGCTATTTTCCAGGCCATATGGCCCCATCTGTGGTTGGTGATACGTCTAGTGCTGCTTATGT
TATGGTTTACAAGCGGTTTGGGTTGGTCATGGACGCGCTGGTGTGGTGTCGTCGCGGTTCTTTTAGCTATCATCGTCATAAACTCTGGCTTGCTCAACGG
TCGGCTAGAGAATGCATGGCAGCCAGTTCGGCAGCATTTGGAACGCCTCCTCCCATTAGCTGACCATGCCCAGGCAAATGCGGCAGGAGGTGCGGTCCCA
CCAGCTGCAGCGCCCGGTGGTGCAAATAACCGCCAAGGGCAGGTGCCTCCTGCTGCGGATCGTCAGAACGCACGAGCTGCGCCGGATCCCCGCGAGGCTG
CTGAGAGAATGGTGGCCGCTCGAAGGGAGGCGAACGCCAACTGGCTGCTCGATCAGGTTCGGCGTGTGGAGCGGGCTGGTCTTCTCTTTCTTGCCAGTAT
CGCCCCTGGTGTTGCTGAGCGCCATATTGCGCATATTGAAGCGGAGGCCAGGGCTGAACGTCAAAGGCGGGAAGCTGCTGAGGCAGAGGCCGCCGCCGCC
GCTGCTGCTGCTGCTGCTACTGCTACTAGTGATGCCGCTGAAGCGGAAAACCTGCTGGAGACGAAGCTGAAGAGCAGGGTGCAAGGCAGGAAATACCCAA
CAACGACATTCAAGGCGAACGGACGTCCGGTTTTGGCCGGTGTTACCTTGGAGGGAAGCATAGCTACTGGTGAGGGTTTCGGTACCAGATACTCATCTGC
TGCCCATAATGGAGGTGGTGCAACCAGGACAAAATGTCCCGCGCCTAGACGGTTCCAACCGTATACGAGATCACATGTAGAATCCACACCCAACTTGCCT
CGCCGTGATAGTGATATCAACAGATCGACGAAGGGTTTCCTTTGTCGCGATCCAGACAGCCAACGGAGACTTGACGAGAGGTCGACAACTAAGTGCAACA
GCTTGTGGGATGACGGGTCGAAAGATTCAGGGTCGGAAAAGAGACGAAATGTGCAAAAGGTAAAGCAATCTTTGACAAGGAGAACAAATGGAACTATGCC
TGAAATGCATGTTGGCACTGTTCACAACATCAGCGAGGCCACATGGATGTTGGGTGCTGGTTGTCAGTACTCTCGTGGCGTGACCAGCAGTCCAGAGTCT
GACACGCAAGAGCTAGCTGGTCCTGTGGGACAAGTTTCAGCAATCCTCGATAACATTCAGCAGTGGTCAGCACCCATCAACATGGGATACCGACCTGCTG
GTGTTTCGACAGTCATGGGCTCCTCTGCCGTGGAGTCCTCAGACTCGCAGGATTCAATCACGACTCTAGAGGCGGTTAATCATCCGGTCAGACCTCCCTT
GGCAGGAGACTTAAATGGCTCTACGGCTGGCCCTTCAGACACTGGGCCACCAGTTGAACTGACTGAAGCCTTGGAAAACGATGGCATTGAGACTGACTTG
Position in Contig 872553 ~ 875590 (3038 bp, 287 bp) in Magnaporthe grisea 70-15 supercontig 5.186 (Strand -) (Frame : -2)
Chromosome Chromosome : Not defined!
Contig Sequence
(862501 ~ 885500)

+862501
862601
862701
862801
862901
863001
863101
863201
863301
863401
863501
863601
863701
863801
863901
864001
864101
864201
864301
864401
864501
864601
864701
864801
864901
865001
865101
865201
865301
865401
865501
865601
865701
865801
865901
866001
866101
866201
866301
866401
866501
866601
866701
866801
866901
867001
867101
867201
867301
867401
867501
867601
867701
867801
867901
868001
868101
868201
868301
868401
868501
868601
868701
868801
868901
869001
869101
869201
869301
869401
869501
869601
869701
869801
869901
870001
870101
870201
870301
870401
870501
870601
870701
870801
870901
871001
871101
871201
871301
871401
871501
871601
871701
871801
871901
872001
872101
872201
872301
872401
872501
872601
872701
872801
872901
873001
873101
873201
873301
873401
873501
873601
873701
873801
873901
874001
874101
874201
874301
874401
874501
874601
874701
874801
874901
875001
875101
875201
875301
875401
875501
875601
875701
875801
875901
876001
876101
876201
876301
876401
876501
876601
876701
876801
876901
877001
877101
877201
877301
877401
877501
877601
877701
877801
877901
878001
878101
878201
878301
878401
878501
878601
878701
878801
878901
879001
879101
879201
879301
879401
879501
879601
879701
879801
879901
880001
880101
880201
880301
880401
880501
880601
880701
880801
880901
881001
881101
881201
881301
881401
881501
881601
881701
881801
881901
882001
882101
882201
882301
882401
882501
882601
882701
882801
882901
883001
883101
883201
883301
883401
883501
883601
883701
883801
883901
884001
884101
884201
884301
884401
884501
884601
884701
884801
884901
885001
885101
885201
885301
885401
TTGAAGCCCCTGCCTGAGCTTGTACTTCATCAAGGCCGCCGCGCCTGGGCTCTATCGGGCTCGTGATTGATCTCCGTACAGATTGACGCCTACCCATCGG
CGGTATATGTGGTTGTGTTGGTGGCTGAGGCTGCACCTGCTGTTGAGGAGGTGACTCGAGTAATGTCGCCTCCAAATAGGCTTGTTTCGCCGCAGCGGCG
GGGTCACCGTTGTCTTCCTGCTCCGACATGTCCATAGTATAGAATGCCTTGGCTTTAGGGGCAGGCTTGACCTGCACTTGGGCTGTCACCTTGTGAGACTCCACTGGGGTAGGTTCCCTGCTCGTCGTGGACGGTACCTGGCTGCTTGAGCGTCCAAAGATATTCCACCTGCGTGGCGACTTGGCTCTCTTGGTCAGCTTCTTGGGCCCAAGAGCGACTGGCGGCATTGCTCTTGGTCCCTGCAACACACGGCCAGTAGTCATTTCGATTATACTATCGTCCGATAGAATGCTGGTGTCGTGACTAGTCATGGTCGGCGAAGTGATCTCTCGTGGCGATCTTGTGTTGATGGGCTTGGGGAGTCGCAAGGCTGACTGGTCTCCGCCGTCCTTGAGTTTTTGGATGGACCTTCTATAGGCCAACGTAGACCTCATTTCCAAGGCCGGTCCCTCGGAATCGCTGAGGTCTGATGGACGGCGGCTACCAGTTGCTGTGGATGTTTTGGGAAAGGGTGATGGCCACAAGGTGTTACGGTCGCCTTGAGATGACAGCGAGATATCTGACATATTCCTTGGGACACTTGCCAACAGATTCTGGTCACTTTTGGCGGGTCCAATGTTGTTGTTCTGAACAACCTCACCACCAGCGATGACAACGGGCTTGGTACGTTCCAGCAGGAACGGATCGTCGGACAACCTGCTCTCCAAGCTTTCCTGCGAGGACATTGTGCCGGCGATTCCGCGGCTCAGGCTGCTGCGGCGCCTGTGAGGCATGCCGACACGCCCATAACCTTCGTGTCCCGTGCCAGCAGCAGGCCCTTTTCGAACAGGCTTTTCCTTCTTTTCGGTAGCCTTTTCGGGGGCCTTTGAAGGTTCATCACCAGCAGTCTTCCGTCGCCCAAAGAGAAATCGCGTCCTGAAGTTCGTGACGCCGGGGCTGGGACTCCGGCTGGTCGTTGATCCATGGCTGGGTCTACGAGTCTCAACGGTCCGGGGTGCAGGGGTGGGCTCGCGTCCAAGGGGAAGTTTGGATTGGGGTGGCTGCTGCGAGGGTGTCACAGATCTGGAGCTCTGATAGGCTAGGCTGGCAGTATCGTTGGTTCCAGGGCTCATTGGCAAGCTCTGGCGCCTCTCGCCGATCGAGGTCGACGAAAGATTGCTTTGGATAATGGGTACCGGCATTCCATACTGCGAGAGCAAATCCGGGGTTCCATCTCGACTCGGCCTGATCGGGGGTGTTGCTCTTGGCACGACAGAGGGGCTAGGGGGTTGTATCCTGCTGACAGGGGGCTTCTGCACGCGTCCTTCTGTTGTCTGTGAGGTCATCATTAGCGGCGCGGGCTGACGAGCTTGCTTCGAAGGAGACGCCTCTAGGCCTCTTTCCTTGTGTTTCTCGGACGACGTTCTAGGAGGAGGACTTGGCGGTACTGTGCCGAGTCTTCTCCTGGTCCTCTTTTCGCATTCAGGCTCTCGTTCAAGCTCGGCTTTCCTGTCTCCATCGCGGACTGTCGAGCCTGATGATGATGAATTGAGTGCTTCCCTAACAGCTGCAAGACCATTAGGGTCAGCGCTCGCCGCACCACCAGTGTCATTTGGTATGCTTCCGGCTCTCCTCCTTGTGACTGGCGGCCTGGAGCTCTGACCGCCGGCGGGACTGTTCTGCTTCAGTTTAGCTGCAGCAAACCGTCCAGACGCAACGAGTGCCGGCGAATGCGAGGGGATTGAGGTCGTAGGAGTGGTGTCCCTGCTGTATGGACAAATACCAGGAGAACCAGAGAATCCAGTAGAAGGGCTGCCGCTGTAGCCGCTGATTTGGCTGCTAGTTCCGGAGAAAAGAGGCGTTGGTGGCGGGAGATCGTGAGTGGAAAGGGGATAGGGAACTTCTATTGAAGAACCGCTACCAGCATGGTATGGTCTTGCGCCTCCATAACGATCCAACTCTGGGTAGATCCGTACCGTTTGGGCGTTTGTAGTTGGGAGCTCGACTCGCATCGCAACTTTGATCTCGGCAGGCGACTCGGTGATGCTCCGGTCGTATTGTGAGCTGTTGAAAGACTCTGGTGACATAACAGAGCGCGGTACAGAGGAAGCAGAGTCATTCCTTTGTGGGACCATCCTGATTTCTTTGCGATTTTCAACGGCATCTTGGATCATGTTCGAAGACCTTCTTCGCAAAACATTTCGAACCGGTCGCTTCTTTTCCTCCACGGGCGTAGTGGAAGGACCTGGGACGGATCCAGAGGCTAACCTTGCAGGACCAGAGATGACAGTTTGAGTAGAGCCTGATCCCCAGGACTTGTCCTGGTGTGTTAATGGTGGCCTTGAGCTCCCTTGCCTGGATGGAGGTTTCCTGGCTGGTCCCTGAGGTATCCTACAAGAGCTTGGCACACCAGTTTGGAACCCAAAGGTTTCCATGTCTGGTCGGGTACTCTTGAGGGCAGAACCAGGCCAGTTATCGCCAGAACCTTGTCTGGTTGCATTTGTTGACTTTGAAGAGGCAGTTTTCGCTGATACGCCCTTTTCCTCAGACCGACCGATCTTTGGGATCGACCCAAATCTGAGAGACGACGACATATCGAGCGTGCGTGCTTGGTAATTATTAATGGCGGCGGAAGCCGTGTCGTAATCTTAGGGGTATATCACCAATCCATCCTTGCTTTCAAACGCACAAATATTCGCAAAGCCGGCTATGTTCTATGGGGTGGTCAGCGATCGCCATAGGAAAATGCTGACAATGTTGCACCAAAGAGGTTGTGGGTAGCGGTAATCAAAAGCCTCAAAACCGGCGAAACTAGGCAGACGGTATCCAGGGTAGTGTAAACGAAAGGCGCAGTAGATGAGTTGTGCAGGATGACAAGGAAATAGCATCGACTGAGCTCAGCATCCCGGAACCCCCGGCCGAGTGCCTAGATCTCTTGGAGATGGAAAGGGAAACAAAAGCAGAGAAACATGGGAGACTCAGAACCTTAAAAAGAGATCGAAATTTTCAAATGCAGTTTATGGTGTGAATAGTACTTTGGGCAGGGGGCACATCTTTGAACACAATGTAACAGTGAACGGGAAAAGGACACTAACCTAACAGGTTGTTCGCGTATAAGTCTTTTGGCCTTGGCAAATAGTTGCGACGCTGTGTGGGTGGGACGGAGTGAGATCGGAGGTGATGGTGTGGAACAGGTAGGCAGCGCCTAAGCCTGTGGTTTCCGCCGGGCAACGAACTGCTTAGCACACCACCACTGTAAGTCGGTTCAAGCTGGTGGACAAAACGGGTGTATTACCGATGGCACCCGAGTGATGGCGGATTTTAGAAGATGATGATGGATGTGAGGTGAGACACTGCGTCGAGCAGCCAACTTGGATCTAACAAGCAGTCCGAATAATGTATATTTAAACAGGTGAACAAATGTATAAAACGAAAATATGTCCTCGTTAGACAACAATGGTCAAGGCAGACGAAAGAAAAGAGAGACAGATGCAGCAATGCAAAGAGCACTGGGATTGCGGACAGAGGGATTGAAAAGGAAGATAGGCCTGTAGAGCAAAGTACTCTGAATGGTTAGGCGTATGCATCTCCCACCCACTTAGATCTGGGCGATACATGGCAAGAAGCTGAGAGGGGGGTGTGTGGCCAAGATGACGATACCCCTCGCCCACCGATGTGGGGGTGAAGAACGGGGGGATCAGCACGGAGTGGACAAGGCAATAACCATGTCGATTTTACCAGGCTTCTGGTCTATCACCCCGTTTGCCCGTCCCCAGTCCCGGTCCTGGTTAAGAAAAGGGCGAAGTGCAGATAAAGTCGTCCAACGAGCGTTGCCTAAACGGCTTCCAGAAAACGGCTTCCAGAGAAACGCCTCGCAACGGAGAGGGCACGGCTCGGCTTGCGGCCAAAAGAAACATTTTCAAGGTGAAGATGCTTTCTTGCTTCCGCATGCAAGCCAGGCAAGCCCCAAAACCTTGAACAGAGAGAAGAATAAAAGAAAACAACCTCGGCTCTTCACTTGAAGATTCAACCAGTCGAAAGTCCGCGCGACCAGTGATCTGAGTCACTCTATGCACGAGAGCGGGTTGGCGGGAATAAGTTGATTCAAAATGGATGGCCAAGGGGAGAAGGTAAAAAGAAGGGAAAATAGAGAAAATTCAATGGATAGCTGTCTAGGAGAATTAATCCCAAAGTAGCATTCAGTACGGCAGGCGAGCCGTTAAGGCGGGACGAGATTGGACGGCAGAAGCAAGAGCACAGACCTGGGTTATTGCTGCGCCTCCAGAAATAACTGGCAGAGAACGGGTGCGATTTGGGACCCTTGGTTGTGCATATCGGCGTGCCCTATGGGAGCACAGCATCCTGCTCTCCAGGCTATCATTGGCAACTTCAACCCCCAGAAGCCCACAGTTCGGTACTGGTGCCACCATCGACACCGTGAAGTAGCCCACCATTGCATGAAGTTTTTTTTTTTTTCGCGTACAGATTGCTGTGTTCGGCAGTCGAGGCAATCCAGTGTAATGTTTGGCTGACTGCTGCTTTCTACAAAGTACAGTACATATTTCGATGCGTACTAAGTGCTTTGGGCAGCAAACAGATCGTATTTTTTGTCAGTTGTCAGTTCTTACTAAAACGCAGACAGGGATTTTGAAGCCATACAGCCTTCGATCCAATGTCACCCATAAATCTGGCAAACAAAAAGGATATTCATTCCTCCCTTCCAGAAATGACGCTTTCTTGACCGCAATTGCTCGTCTCGTTTCCGCAAACGGTCACGCAGCACGAGAAGGAATCTTGAACAGACGGTGAGGCTTGAACACGTGCACATGCTGGGCGGCAAGAGGCGCGGATTCACAGCCGATGAATTGCCAGTTCAAGCCTCACCTTTACGCTGCCCCGTTGCCCAGAGACGGGCAGGGTTGCCCAGAGACGGCAGGGGGGGTGTCGAGTGAGGGAGGGGCAAAGAAAAGGAAATCGCTTGCGTTGTGGGTATTCAAAGAGGTCCCACAAACTCCACCATAGAAGTCCGACTCCAGCTGCCCGCCTTATCACAGCCCTTCTATAACCTCCCTCACAGGCTCTTCCGCGGCGTGCAATGGGAAGCCACCGCTGCAGGCATGTGAGACATTGACATCGGATCGGTTCTTTGGATTCGGGTCCGGTCCAACGACAGCCGCAGGAGGCATTTTCGCAGCCTGCAAGTGTTTTGCCAAAGGTTTGGTTTCCCTTGCGGCATGTCTTAGATTCCTTCTGCGCACGCGCTCTGGGGAAGCACGGCGTCCTTTCCCCGGCGCTCGCCAAAATGACGACCATTCCCATATAGGTACTTAAGATATCTGCTGGGTCTGGCGGGTAGCCGGTAGTTGACTGTCCTTATAAAAAAATTCCAGATTGGTCATTTACAAAGTAGCTCGTCAGCTTAACGGCGCTAGCAAGCCCTAGGGAACATTGCGGCCAGCGCATATGCGTACCTAAATGGCTCGACTTATTATGCGACTATGCTGGTGGGCTAAAAGCCTGGTCGCATGCCAAAATCAACGTCGCATTACCACATGTTTGAACTTTTAAGCGCGCAGTTTGGTCGGGGTGCTTGTAGTTCCAGCCCCGTGCGAAGCCGTGGACACTGGGCAGAACCCAATGGCATTCCCATCTCGGGCCTTTACTTGCGGTACGACAGGGTACTGTGGGGAAGCTTGACGCACCATTGCCGATCTAAAAGAGTCACCTGTTTGGTTTGGATACTTTGAAATGCAGATTCTTGACGGTGAGAAGGGATTCTTCGTTATGGTTCTCGCTTATTCGCTTAGTTTTGACGCTTGCTGGCCCCCAAAAAGTCGCAAAAAGAGCGCAATCTGAAGGAGGAGTAAACAAATGAATTGTGGTGGGCTGACAATCAATACCAAGTTCGCGGGAGCCAATGTTAGTGTCCAAGAAGCACCCCAAACACAGATCCTTGTTTCGCATGTATAGTCTGCATCATCGCCGACTCGTAAATTCCATATCCATTACCGAATGTGGCACTACAACACAATTAAGGTAGGTAAGGTAGGTATTAGTTAGGAGAAGATGAAAGGAGATGACCAACTGGTTGTTTGACTCGAAGCAGGCCTGAAGCGACATCGTTTGAAGGAAGTAGAGATGTGTAGCAGGCCAACAGAATTATTTGATTGGCTAGTCTTTACCAATTTAGAGCCAATCAAAGTCCCCAGTCGTGCGTCTATCCTCTCTATGCCCCTGTCTATCGTCCAATATTTCTTGATGAGGGAGGGATGACCCCACCACACTACCATTGCTCTCAGCCAACCAAAGAAGCTCTGTCTTAATTGACACTGACGATTTTCTTACAGAATTGCTGTACGCAGTATTACTGGACTACTGTATCAGGTAACTGCAAAACTGGGTTCTGAGTAGGTACCTAGGTAGGTAAGGTAGATAGATACCTAGATTTGACATGAACTTGGTATTAACTGACCCATGTTTACGAACCACAATCACCTTAAACTGACTTATCAAACTTTAGTCTAATCTAGGTCAACTGTTACTCAACTCGTTTGTTGGTAATAAAGAGCAGGAAATAAGGAGAACATTTTGTTATTACCCCCTGCACCGGACAAAGTAACCAACCCCTCAACGCCCAACTCCCAAGTTCCACACGCGTAGGGTCTGGAACAAGTTCGAAATGGCGTAAAGAGGGGTTCACAAAAAGCCGCACATCATACAGTACAAAAGTGATAATCGACAGGTCAGTCAGCATTTCCGCGCGCATACACAAGACTGACTACTGGCTCCCCTTCCAAACAAGAAGAGGGCCTTCGGGTTTGCACAATGGTACTGTCCCCATGCATACCTGGCACATGTCGTTTATGCAGGAGCGAAACCTGTTTGTGCAGTTGCTCGGCTGTTCCATTGGCGACGAGGAGATGGTCTCGGCCCTTCAAAGGAGTCCTAACCATTCAAATCTCAGCCTAAAACGATTCGTATACATGCGTCGCAAATCCTTCAATTTTTTTGTTCTCTAATCATATCAGGTCCAATTGTTGTTCCTGACGGGAATATCGAAGATCACGGGGGGGCAACGTCAGCTGATTAGCAAGGGGGTGTAAGGGTATACTCCGTATGCAATCAAAGAAGGCACTGCCAACCGCACGCACGCACAGGCTTTTGCCCACTTTTTGGTTTCTCGGTTCTCCCATGCCGGCAGCAACTGCAGCCAAGTATTCTAAGAAAAGAATTAGACGAGAGCGAGGGACCACATAGGCGGCCAAATCAACGGCCATCTTCGTGTATGTAGGATATGACAGGCAAAAAAAGTTCCTTGTACATGCAGAATGCAAGCCATACTAGTGAAGCCGCGTTATAACATGCCTGCTGCAGGCTGCATCATGCGCTTTTTTGTCTCTGGGAATTCCGAGATCCTAGGCGAGCTGATGCCTAGAGGTTTTTTTTTTCTTTTTTTCTTTTCTTTTTTTTTCCCCCTTGGGCCAAACGCCACGTCCCAAAGTGGCAAGGCCCGAAAAGTTGTTAGCCGCCAGTGTATATTTTGTGCCCTTGCTGTGGTTGGCCCTGCACTTCGCCACCGAGGCTCGTGACGTGGCCAACAACGGGCAATAACAAGGCGAGCAGTAAAAAAAAACCCAGCATCGTCAAAAATCGGAATGTGGCTGAGGCCTCAACCCCCAGGCCTTGCTCTATGTACAATGACATGTCTATCGTCCAAGATGCAGCCGGCGGCCTCTTTTGCTTACGTAGCACTGAGTAGGCATCTCGTTTTCTCCCTGCATCATCCCATGTTGCTTTAATTGTTTTTTCGCCTGCCAGCTGTCAATTTGGCCACCTTGTGAACAAGGCCCTGGCCTGCGAACGCAAGCGAGCGACGAGGGAAACCAACGACAAGGCCATTTTTATCTCCATCCTATAATTACCTAGAATTCCAAAGCAACACCAATGAGTTGCCAACGACAAATACAATTAAAAAGAGGATCGAAGTTCCATTCTTCTTCACCCCTGCTCACCAGATCAGAAAAAGAAAAAAAAACTCGCAACCCAATCGCAGGCGCCGAACAGGGGTTCATCTCTAAGCATGGGTGTTTGCCACTGCGATTGGACCGACGGTGAGACCACACAGCGGCAGGGGATCTGGGGACTGGCGTCCGTCGCAATCAACGTGACTCGGAGATGGTGTGTAGCTATCGTAAAATTCCTTTTTTTTTCGTTATTCTGCTTCTTTGGCTTTTCGGGGATCGTCAAAAGCCGTGTTCAGGGGAAACGGGACGAAGGAGTCGATCTTCTTTGCACTTAAACGGCCGGTTCGTTAAATTATGTGGCTTTCCAGGTAGGAAGGATATTGAGAGGGTCCGGCATAAGGAAGGATGAGTGTTCGGTATCCGACCTACTAAGGAACAACACCAAGAGCTACCACTATCATCCACTTGTTTTCGGCCCAGCTGAGGTCTTTTCAACGCAGGGAATGTCCTTGCCAGAAATCCCCGGATCCCAACGCCCGGCGGATGCAGCCGTTTTTTTTCTCCTGACTTCAGCTAGGTATAGACCACTCACTTAAAATCCCCCAGTTTTTGAAACTACCAATCGTCTTGTCAGGATCGAGAGCTGGAAGCAATAGGCATATCCGTCTTGATCTTTCCTGCATATACACCCAAACGGCATGCAGGCATCATGGCTCGAGGCTACTGCACCGGATGTCTGCTTCCTAGCAGGTATAGCATCACCATAGTGTGGGTTTTCCTAAACCTGCGACGCAATCAATATTCACGGGGAACATCTGTCGCAAAACGACATGTTTTGTCATATTTCTCGCTTTCTTCTTTTGTAGGCGTCATATCGGGGGCACGGTCTAGACTTCCGCTGTCTACCAACCATCACATTACAACCCCCTTTTTCCAGCCTTATAGCTGAGCCCACGGACCGTTGCTTATCTACTCTAGAACCATCATCACCATCCGTTGCCACACCCAAAAAATCTCACAGCTAGCGATCGAAGTGTGACAGGGCGTTTTGCTTGTCTTGCTGGGGGTTAGAACTAGGACCAGACCTTTCCTTGTGTGTCCATCTTGGAAACCCTTTTCCCCGATGCCCCAAGCCAGAAAGCCCCTTGTTCCTCCACAGGTAATATCACGTCATCTATTTTCCCCTTCATCATGGACCTAGCGGGTTTCCCCCCGCGTTGTAAATAACTGCTGCTCTCTTTTGCAGGCAATAGAATTTTTCCTCATGGCTGACCGGCTCACCATATCTTGGGGGCCGATCCTTCATGTTCTTTCGACACCGTATGGAGTGATGTGATACGCGCTTTTCTGTGACTGCCTTGCACTGTCTTTTGCTCCCATAAGCTTGCGCCAATGGCCTATTATCTCGCATTCCCCAGGCATTCCCAGATGTCTACATGTCCGGCAGGAAGATGGCTTTTTCGTAGCAGCAAGGTCCGAACGTCATCAATTAGTGCTTCCTTGGGGCTTGGCCAGTTGATAGTCATGTGTTTTTTTTTCAGGTTTTCAGTCTCTTAGGTCCACTCGATCCCTCGGTAATTGCTTACTATGCTTGGGCGTCCGTCCTCAAAAGATTAGCTGGAAGCGGCGCCATCATCGGTTGACGACCAAGGTTTGGCTCTTTTGCCGGTTGACTAAAAGGCAGACGTAGCTATGACGAAACCAATCTAGACGCCCCTGTAGGAACTCGTTTTTGTGACAAATATTGCAATTGCTTCACTGATAGCTCGCTCATATGCTCAAGGCAGTAAACTGCCGAAAAGAAATATGGTGGTTTCTAACAAGAAAGACACTGACGCTATACGAAACCAATGCTGAGCACACATATATGCTTCGAAAGCCTCTTCTCAACTGGCCCGCCTCCATAGTCCTAGCTGCCGTCCGCTTCGCTCTCTGGATAGTTCAACCAATCGGAAAAGATCAAGTCAGTCTCAATGCCATCGTTTTCCAAGGCTTCAGTCAGTTCAACTGGTGGCCCAGTGTCTGAAGGGCCAGCCGTAGAGCCATTTAAGTCTCCTGCCAAGGGAGGTCTGACCGGATGATTAACCGCCTCTAGAGTCGTGATTGAATCCTGCGAGTCTGAGGACTCCACGGCAGAGGAGCCCATGACTGTCGAAACACCAGCAGGTCGGTATCCCATGTTGATGGGTGCTGACCACTGCTGAATGTTATCGAGGATTGCTGAAACTTGTCCCACAGGACCAGCTAGCTCTTGCGTGTCAGACTCTGGACTGCTGGTCACGCCACGAGAGTACTGACAACCAGCACCCAACATCCATGTGGCCTCGCTGATGTTGTGAACAGTGCCAACATGCATTTCAGGCATAGTTCCATTTGTTCTCCTTGTCAAAGATTGCTTTACCTTTTGCACATTTCGTCTCTTTTCCGACCCTGAATCTTTCGACCCGTCATCCCACAAGCTGTTGCACTTAGTTGTCGACCTCTCGTCAAGTCTCCGTTGGCTGTCTGGATCGCGACAAAGGAAACCCTTCGTCGATCTGTTGATATCACTATCACGGCGAGGCAAGTTGGGTGTGGATTCTACATGTGATCTCGTATACGGTTGGAACCGTCTAGGCGCGGGACATTTTGTCCTGGTTGCACCACCTCCATTATGGGCAGCAGATGAGTATCTGGTACCGAAACCCTCACCAGTAGCTATGCTTCCCTCCAAGGTAACACCGGCCAAAACCGGACGTCCGCTGTACACAAGATGTTGATACTCAGTAGTATAATCCGACCACGCCTCCACCTGATGGAAAATCAACCCTGCATGCGGAATCGCAGGCATAGTTTGATGCGTGAGCTAAGCGCATTGCGTCTGTTGTGCAGCGACTTCGCCTTGAATGTCGTTGTTGGGTATTTCCTGCCTTGCACCCTGCTCTTCAGCTTCGTCTCCAGCAGCTGTAGTAGATATCCCATGTGTGGGTGCTAGGGGCTTATCCGACACTTGATCTTCCCCTTCTGTACTGCTTACGTTTTCCGCTTCAGCGGCATCACTAGTAGCAGTAGCAGCAGCAGCAGCAGCGGCGGCGGCGGCCTCTGCCTCAGCAGCTTCCCGCCTTTGACGTTCAGCCCTGGCCTCCGCTTCAATATGCGCAATATGGCGCTCAGCAACACCAGGGGCGATACTGGCAAGAAAGAGAAGACCAGCCCGCTCCACACGCCGAACCTGATCGAGCAGCCAGTTGGCGTTCGCCTCCCTTCGAGCGGCCACCATTCTCTCAGCAGCCTCGCGGGGATCCGGCGCAGCTCGTGCGTTCTGACGATCCGCAGCAGGAGGCACCTGCCCTTGGCGGTTATTTGCACCACCGGGCGCTGCAGCTGGTGGGACCGCACCTCCTGCCGCATTTGCCTGGGCATGGTCAGCTAATGGGAGGAGGCGTTCCAAATGCTGCCGAACTGGCTGCCATGCATTCTCTAGCCGACCGTTGAGCAAGCCAGAGTTTATGACGATGATAGCTAAAAGAACCGCGACGACACCACACCAGCGCGTCCATGACCAACCCAAACCGCTTGTAAACCATAACATAAGCAGCACTAGACGTATCACCAACCACAGATGGGGCCATATGGCCTGGAAAATAGCCGCTGCTCCTTGGGGGTCGGGATGGCGTGCCCATGGAATTACTCGACGAGCATCCTGCATGCGCCGCAAGGCAAGTTGCTCTTGAACTCGCTCATGCTGCTGCCTGAGCTGTACATATCTTTGCCTAAGCTCAAATTGCCGTCGTTGACCATCTTGCCGCCACCGCTCCAAAAAGTCAGTGTCTTCTGTTGCTCCAAAGTCGTTCGTGGCGAATGGCTGACTGCTGGCAGGTTGGACACCACCGACCGGGAAGTGGGCCGTGACCAGATTTGAAAGGGATTCTGTCGGCGTTTCAGCCGAGTTCGTCCCTGTGCTAAGACTCGCAGGCTGCCCAACTGGTAACGAGGTATAAACGCCACCGTTGTTGAGAAGGACGGCATATGGACCTTCCGGAGAGTTCAAGATATACACTTCAGGTGCAGATGCCTGAACAGCGCCATTCTGCTGGCTGGAGGTTTGCTGTGACAATTGATTGTGGGGGATCGGAGCCGCCGGGTTTTGCGAGCTGAGCTGAATGTTCATTCGGGCTGCGTGCACCTGTTCGGCGTTGCCATGGAGTTGTGAGCTAAGCTGATTGATCCGTTCCTGCCGGGCGCGGGTTGCCTGCAGTTGTTCTAGGAACCTAGTTGCTTGTTCCCTGGCTCGGTTCTCTGCCATGCTTTGCGCAGTCTCACTCCACAACGTATCACTGGAGCTGCCAGATGCTTGCCCAGTTGGGAAAGGGATACTGCCAAAGCTTGATGTTGTATACCGTGCGGCGCTACCCGTACTCGTCATAGATGGTGGTTCTGCTGGTTGCGAGATCGTGGGTAGCTGAGGGTGCTGATCCTGTATACCGAGGCTATTCCGGGCTGCTCGCTCTCGCTGGTTCTGTGCAATAATATCGCGGGTGGTGGTGGCCATAGGTTGAGTTGGAGATGTTGTCGACGGTGACGGCTCCGTTCCTGCAGGAACCATCAGGACGACGTGTAGAACGCGGCGGTTATCAGTGTGAAACTATATACAGCCCGAGGGGATCAGTAATTGGACACAAAGATTTGTTTCGCTAGCAGGCTCGTTTGACCAGGAAACCATACAGCATCTGCTCCGAAAGCATCTGACAACTTCATATCGGGCTGCGCCAGCATACGCCCGTGATAGATCAACCTCATCGCAACAGCATTGCGGTTCGGCAGTGTTAAGTTCATGCGAATCTTGTCCTGTAACTGGGCAATGGTTGTGTGCGCCGGTAGGTCCGGAAATGTGAGCGGGGCGGGCACACCGACGGACGGCGAAACGATGTCGAGGGTCACGGTGGTGGCATCTGAATTGTTGGCCATGATTATTGGAAGGCGCACACGCGCCGGTGGGTGCAGCCCAAAAGACCCGGTGTCGATACAGTCAAACTGTGAATTCACGGGATGGCGGCGTTGACCAGGGTCGGTCAGCTTTGGTGGACAATATGGGACCAAGAAAGGTCGGAGGGATTGGTGACCATATGAGAGAACCAGGCAGCGGATGACGTCGATTTATGCGGTAGCAACGTGTGGTAGTCCAGTCCAGAATTGCAGGCAAGATGAAAGGACTGGAAAGAGATAGACGAGAAGAGGTATCAATAGAGTTACGGTAGACAAAAACAAACACAGACTGCGATGAAGAGAATAACGAAGAAGAAAAAAGGTCGATGTGGCTTGGATTGATTATTTTTAGCCGTTGAAGGTACAGATTGAACCGTTTCTTGCATGGTTTGACTTTCATCCAGCAAGGTGGCCAGACGGAGCTAGATTAATTGGAGCGTCCCGTCTGTCCCGCTGGGTGACTGCCTGCGTCTTTCAAACCTGATACTGACAGGCGGGGGTTCGGATTACTCGGCGCTGGTTGGTCGCATCGTTATCATCCTTCCGAGAACGGGACGCAACAGTACTTTCTGCGCCTTTCCATAATTCTCTGTATTTACCTACCTACCGATGTAGGTACATGGGCATCTAAGTTCAAGAGATAATTAAATGAATACATATGGTTACAATAGCTTACAACGTATGAAACTCAAGTTACTGACAACAAGCCTGACTGTCTGTGGGATTTATTGTATTGAACAGTGCATCATGAAACCGCATAGTCAGAGGGAATACTGACATGACATGTATGCTAATGCTTGCTAGCTGCATAACTAAAGTTTACCTCAGTACCGCACCATACTACGTACCACGTATATACCTAGGTACCTACCTACCTGCCATGACTGCGGTCCCTGAGCTTGATCCACTTTTACCATCGGCACTAAGGCAAGCTTTTCAATTGTCATCTCAACACCTCGACTGAGATAAAAACGCATTCAGGTGACGTTGTAAATTGTGAGGCAAATTCTATCGACTGTCTGATCAGTACCGTAAAAATCCTCAAACTTCGATACCAATTGCTCGACCGCAACCTCAAAGCGAATCACGTGCGAGAGAGCGCATCGGCAAATCAATCAATCCGCAGGCACGGTGCCACCTAGAACGACCTAGACGTCATTCAGATTTTCCGGGGATGGCCCAAGCGACAACGTTAGCATAAACGACCAGGGTGTTCCCCTTTATCACGCGATTGTGCCAATTTCCCGCAAGCAACACCACGGGTAGCGGGCGTGGGCGCAAAAAAAAAATTAATATACTAGACAACGAATAATCCGTACTCTCCCCCCGCCCTCCCGGACAACCATGGCTTCCACTATAGCCGCCCGTACACGCCTAGTGGCCAGGTCGCGTCCGATGCACACGTACAGCTCGACATATCTCTACTCCCGCGCGCCACCCCCGAGCCGAGCATGTTTTCCCTCTGGAGGTGCCGGCAGCGGTGCTGGTGGCTCGCGGTGCTACTCGACCCATGAGACCCCCAAGAGGCCCAAGTTCACCTCGAGGCTGCGCTCTGCATGGAAGAATTCGAAAATCACCTGGTACAATATCCCGGTCGGAGTCGGCATTGGGTTTTTAGGACTGGTGCAGTTTTATAGGGTACAGAGGAGGGAAAAGGACAGGTTAAAGGATGAGGCCGATGCCGACGCGGACAGCCTATCAAGGCCCAAAAAGAGGCAAAGAATCAGGCCAGATGGACCATGGTATGCATTGAGTGCCACTGGTGACAGTCCGGTTAGACCGGATAACTTTGCGTGGGCACGGTACTGACTGGCAATCTGGATTTCTAGGCAGGTCCAGATCATGTCTACTTTACCCCTGAAAGCACTATCGAGGTTATGGGGCAGATTCAATGAGCTCACACTTCCTTATTACCTGAGGATTCCTGGTTTCAAGCTTTACTCTTTCATCTTTGGCGTCAAGTACGTGTCTCCCAAAAAGCTCCTCGCATTCGTACCTGGGGCTTTACTAACAGCCGGCTCCTCCAAACAGCCTAGATGAGATTGAAGAACAAGACCTCCACAACTTCCCCAACCTAGCATCATTCTTTTACCGGACGCTTAAGCCTGGCGCCCGTGTCCTCGACCCCAACCCCCTTGCACTTCTCTCGCCATCAGACGGCCGTGTGCTGCAATACGGCCAGATCGAAGGCGGTGATATTGAACAGGTCAAGGGCATGACGTACAGCATAGATGCGCTCCTCGGCGAGACTACACCTTCCAGGCCCGGCAGCCTGGCATCCTCTGGCACCAGCACCCCGAACCCGGCGCAGGACGACGAGATCGTGAAGCAGGACGAAGAGTTTGCCCGCGTCAACGGCATCTCGTACACCTTGCCTAACCTACTGTCCGGTCCGTCCTCGAAATCCAACAAGACCGACCAGGATCTCGAAGACCAGTCCGTTACGCCGTCGCCGGCGTCAGTCTCCCAGGTCCGCGCCGATTTAGAGCTAGGCGAGAAGCCGTGGTGGTCTCTCCTGGCCGAGCAGCGTCGCACCAAGCTCTACTACGCCGTCATCTACCTCGCGCCGGGCGACTACCACCGCTTCCACTCGCCAACTAACTGGGTCGTCGAGCGCCGCCGCCACTTTGCCGGCGAACTGTACTCGGTCTCGCCGTATTTGCAGCGCACGCTGCCGGGGCTCTTCACGCTCAACGAGCGCGTCGTGCTGCTCGGGCGCTGGCGCTACGGCTTCTTCAGCTACGTGCCCGTCGGCGCCACCAACGTCGGCAGCATCAAGATCAACTTTGACCGCGAGCTGCGCACAAACTCGCTCACCACCGACACGGCCGCCGACCGCGCCGCCGAGGAGGCCGCGAGGCGCGGCGAGCCCTACAGCGGATATGCCGAGGCCACGTACGAGAACGCCAGCCGCGTTCTGCACGGCCACGCCCTCAGGAGAGGCGAGGAGATGGGTGGCTTCCAGCTGGGCAGCACCGTCGTGCTGGTGTTTGAGGCGCCCGCCCCGAGGATGGAGGGCGGGCAGGTCCAGGATGGCTTCGTGTGGGCTGTCGAAAAGGGGCAGACGGTCAAGATGGGACAGGCGTTGGGCAGGGTTGTCGATGACTTGTAACAAGTGCTGTTCTCGTCATTTCTTGTTGTGTGATAAAAATATTACAAGTCTAATGTTTTCGTGCTCAATTCTGAGTTCTATCTTTTTTGTCTCCTTTTCTCAGAAGTATGCTTACTGCCTGGTCTTGCTTTCCGAAATACTGTTATCTACCTGGGCCATGACTGAAGCGATATACACACTAACAACAGTACTTGTAATGCGCGGTTGTTGTGAATTTAACCGCATGGCCTGCTCCGGCTATTTTTATCACGGAACCACTTGTTGCTGGGATGATTAACCGCTGCATGTACGGAATCTTTGCCAGGCATTACGCCGATCTTTTGAGGAAGAATCCTTTTGCAACGAATGAAAATTGACAACCCCATGGGGCCAATGATGACGTGAGGTGCACATCAGATCTAAGGCTAGCGAATTGCACGTGGTTGGTCTACGCCCTGCAACGACATCCGTGTGATTTGTTGACGAACAGCCTGGATCTAATCATTGTCAACTGTTTTTTTTTTGTTTTTTTTTCATTTGTATATCTGGCGCTTTATGCATTTCCAACTCCGCGCTCTGCACGAAAAGACACTACACATGGAAAAAAGGATTCTAAACCCCCCTCTTCAATAAAATTACCACCCACTATATATACAAAGTATCCCTGTGCGCCCAGCATATTTTTCTTTGGCTCCTTAAGCACCAAAGACCTTGACCTTGGTCTCGAGGGGAGCAAACTCCTTGTCGCCGGCGCTGCCGAGCTTGTTGCCAAAGACGAGCTGGGCGTTGAGCTTCCACTCCTTGGGGATGTTCCAGGTAGTGGCAACCTTCTCGTCGACCAGGGGGTTGTAGTGCTGTAGGCTGGCGCCGACGTTCTCCTGGTCGAGGGCGACCCAGAGGGCGTACTGGAGCATGGCGTCCGACTGGGTAGCCCAGAGGGGGAACTTGTCGGCGTAGGTGGCGAACTGGGCCTGCATCTTCTCGACGACGGTCTGGTCCTCGAAGAAGAGGATCTGAAAGAGGGGGAGATGACTTGTCAGCAAGTGCTGCAGTGGAAAATATAGGGAATGATGGGGTGACAAGTTTGTGAATGGGAAGGAGAGGAAAGGGAAACAGAAGAACTTACAGTACCAGCGGCAGCCTTGAAGCCGTTGTTCCTCGCCTCAGTCTCGGCCCAACCCTCAGCAGGCACGATGGCCTTGAGGGTCTCGGCGACCAGGTTCCAGAACTTGTCGTGCTCGTCACCGAAAAGGACGACGACGCGGTTGGACTGGCTGTTGAAGGACGAGGGGACGTGCTGGACGGCCTCGTTGACGATCTCCTGAATCTTGTCCTTGCCGACGGGGAGGTCCTTGCCGAGGGCGTAGTGGGTGCGGCGCTCCTTGATGAGCTTGATGAGGCTGTTGGAGGACATTTTGGCGGTTTGTTGTTGGTTTTGAAGAGTGATGACTGGTTGTTCTTGTTGTTGTCTCTGGAAGAAGGCGGGCGTTGAAGAGGTCAAGAAGCGCTTTGGTAGAGTGGTTCGTACGGACGAGAGAAGCGTGCGGGCGACGGTAGGATTCATATAGAAGACTGCGGAAAGGCAGACCACGAGAGCGAATAGTAGATGGCGATGGATGAGGGGTCGGTGGGGAGCACGAGGTGACCGTGGAGCTTCTGCTTTATAGTGGCGGGCAGGATGTTGCATTCTTGTTCGTGGACGTATCTAATGGGCAGGGTATCCTCTCTTTTTTGGATTTGTAAATATTACTGAGCACTGGAAATTCGGCCCCGGAGGCTTTAGTTGGACCTAGGAAAGATGGATGGGGCCCCACGTCAATGCTCAAGGATTTGCCTTCTTGGCCAAAAAAAAGGGACAGTTTGTTGTTGAGAGGTATTTCTATGCGGGAGGATTTGTAACAGAAACAGGAGAGCGTGTGGTGGAAGAATGGACAGTATCCTAGCCACTTGTCCAAGCTGTCTTGTCTGCAGTCTGTCGTCTGTTGTTATCTCTTTTGTCTTCACTACCCTGTTGCCGGTGACCTTTTTCGTCGTGTACAATGTCTGATTCTCCACCGCAACCAGTTCCGTCAGTTACAAAATGCCCAATTCAGTCAAAACCGCGCAGAACTACCCCTCCCCCAACAGGCTTGCTGACAAGGATTGCAAAAGCTTGTGTGTGCTGTGCTGTGGTAAAGTACCTTAGAATGCTTCTTTTGCTCTGACACTGTTGCCAAGTTTTTTTCTACTAGAATAAGTAGTCTTGTCGTATAACTGTATTACACAATGTGTGATGCCCTGCGTTCTGGACTCCTGATTAGGGGTCGCTGATGTGCTACCATGGAGACTTGGCATCATTATCCATTTTTCTTTTTCAGCAGCATTGCTTGCTGACCAATCGCACAACATGGAGACGAGACAGAGTTTAGACATCTCGACCAATCCAAAGCAATGCTCACGGAAGCTCGCGTTTTGTCTCAGTCAGCAGTTTAGCATGTCTGACGGGTAATGACGGTGTAGCCGATGGGTGATGTTTGTGCTTTCCTAAGCATCGCTAATCAAAGACCCACACGGCTGACAGGACCAAGCTAGCTTGCTTGATGGCTTGCGTAATTAGTCTACAAAACATTTTACACCGCAAAACTACAATAGTTTTTACCATTCATGCATTCAGTGGGTTATATTGAAGACAGACAAAAAGACGAAACACGAAATAAAGGTAGCGATTATGAATGATGATTGAATCTCAGTAGGCACCTGTGAAGATGAGATGAACACTACCTGCCATCCTCACTGCAACTACTTCGTATAACCCACAAGTGCCCAATACAATCAATCGACGGCAAGAATAGCCGAATAATTCTTACTAGGCGGGCAGTACCTTATAGTGAACGTAAACTTGCCATGTTGAACAACAACTAGTCTCCCATATATAACTGTGATTTTAATATATCCTCTAGCTACCAACAAAATGGCCTTGCGCCGTGAGGCATGGCAAGCAATTGCTTTAAGTCCATACAAGTAAATAGCCCCCATGGTTTGTTGCGCCTATCAAACTCCAATGATACGAAAATGTCACGCTCCCTACCGGTTCTATCATCCCATGTTGTGGTACAAGTTAGTATCGTAGGTGAAAAAGAGTTGCCAAGAAAATATTTCCCAATATGCTGTCCGGTGAAGCAACAACATCAGTGCCAAAAGAGAGACTACCATGTCTCGGCGATGTACTGCCCCACCTCCTTCTTCAGGTCCCAAAACTTGTGCGCCTCGTTGCGCCCCAGGTTACCCTTCTCCATTGCAACCTCGACGAGAGCCTCTTCCACGCCCTCTCCCATGCCTCTGCTAGAGCCACAGACGAAGACGCGCCCGTCGACCGAGTTGATGATGTACCACACCAGGTCGGCTTGCGCACGCACCTCTTCCTGCACGTATCGGCCCTCTCCACGCCGGCTCTCTACCACGCGCTTGACCTCGTCTTCGTGAACGCCCCACTCGCCGCTGTAGATCTCGTCCACCAGCGAGTCGCGTACTCCCTGGAGTACCCACACCTTGTTGGCACAGTTGGCCGTTTTGAGCCGCCGCTGCACAAAGCCTCGGAACGGCGCGATACCCACTCCCGCTCCGATCAGCAACATAGGCCCGTCCGACATGAACTGTTTGGCCAGCGGGTTGGCCATAAGGCCCTTGAACATGGGGATGTACACCTCGGGGTCGGTGACGCCGGCTTCCTTGGCCGCAATCCACTTGAGCGCCTGGCGCTGGAAGAAGCCAGAGCCGATGCCAGTCCTTGTGCCGGTGCGCCAGTCGCTGTCAACGTGCACCGTGACAGCAATTTCAATGATGCGGTGACGCTTGCCGTCCTTCTCCTCAAACGACATGTGGGGGTCGTTGGAGAGGGAGTAGAACCGCGGCATCAGCGGCTGAAGCACTGACAGCAGCTGGTCCAGAGGGGGCTTGGAGTTAGGGAATGCGTTGAGGAGCTGTACGAGAGAAACGTGCGGTCCTGTCCTGAAGTCGCAGAACACTCCTTGGCCCTCGGCCGCGCACAGGAACATGAGAACAGTCTTCTCAACCTCATCCGTGGTGTGCTCCGCTAATATTCTCAACAAATGCTTGGTGGGCGGGTATGACTGCAGATCCGAGCACCACGACAAAAGAGCCCGCCTGGTAGTGACCAGCTCCCTGGGCTGGTCATCTCCCCATACCGTCGGCCAGCGGCCGTTGGTAGTACGTAGGATGACGGGCTTGTCGCGCAGGAAACGCGGAATAAGGAGAAGATCTAGGATCTCCTCGACCACGGCAGCATCATTGGGCGCAGAGACACCAATTGCACCACCGACCTTGAAGTCAACGCCTTCGCTGTCTGGGTAATCGGTGATATCGAGGTCAAAGTGAAAAGTGCGCTTCTCGGCGCCCGGGCGTGTCAACTCACGAGCGCTGTGAATCTTGGCAGGATAGACGTTGTGTGGCGGGTGTGGCTGAACAAATTTTGGTGGTTGAATCCGTGTGTCGGTATCATCTAGTTCCAAGTTTTGTAGCTTCTTGGCGGCCTCGTCGACTGTCACCTGTTCTGGTTGGGCCCCGGGCTGTGTCTCGGTCTGGCCGTTGCCGCCGAGTGAGACACCAGAGTCTGCGGGTGACGGTGCGGTTTCAATCTCCTTCTTCTGCTTCTTGATCGGCTCAAGAAAAGCTGTTTGCTCGGGCATGTCGGCGACATTTGTCAATGTGCTGGGGATCGCATCAATCTTAAGAAGCAGCGATTGGAAAGCATCATTCTCGGGTAACCGAGGCTTCTCGAACTGGAGGCTGCCCTTCTTGGCGGCATTCTTGAAGCAGCACCCGCCACCACAGCATCGGCTGACGACCTCGGCAGTAGACTCGCCAGTGATACGTTGAATGTCGGCGGCGTTCTGGGCAATTAAACGCGTTGAAGCGCGACGTCGTCGCGTCTGTGCGAGAGGTTCCTCGAGCTCGTGGTCATCCGTCGAATCGGAGAATGTGAGAGATGGCGCTACCGAAGGGGTCCGAGGCTCCTCTGGGATGCAGCCCGAAGTGGACTCGGCTAGTATTGTGTCGAGCCTTGACTGCATTGTGAAGGTTAAAATTGAGCGATGTAGTGAACTCAGAGGTGATAATAATGCGGGACCAAGTTTGGGTAAAGGGGACGACAGTAGGTGTCGTTGGGTGGCGGAGTGGAAAATTCGTCGTTGGGTGATTTTTCCTAGTCAATGACCGGCGTGCATTGAGTGTGGGAGGGGTGGTTGAAGAACGAATTGGTGGCTTTGAGTGGTTGGGGATTGGTTATCAGATCTCAAAAGGGGGATCAGATAAACATGAAAAAGAAAAGTCCGCCGGCCGGCAAGCCTCAAATGTCTGGGTGGGCAAGTACCAAAGTGGCGGTAGCGAGAAATTTCTCACAACTTAAAGCAGAGAGGAATTACGACCTTGGGTAAGATGTTGAAATCAATCGTATGACGATTACTCGGCAATTATGAGAAGAAATTAGTTCCTAATTGTCAGGTATTTGAGATGCCTACCCGAACTGACCATGACGGATTAATGTTATCAGATCTAGAAAACAGCGAAATGCCATGTTTATTACTGATGCGCCCGTCGGGCTGATGAAATACCGCACAATGCTGATCAAAAAAAGAGAAAAAAATAAGTGGGGGTGTACCAAGCCCCTCCCCAGGCCGATAGAGAGGGAGAGCGGAGTTGGAGCCGAGATCAGGAACCGACCGAGTTCGATTCACACAGCCCTGAAGCCATCAAGCGCCAAAAAGGTTCGATCCAATTCCAACTGGCCAGGACAGGGTCCCTTGCAACCCTCCTTTTACTTTCAAACCCATCATGCCAAGTTCCAACAGGCCATCTGGGAATTGCTCTGGAAAGGGAAACAAAAAAGAGAGCCAAATTGTTTGTATCATAGCGTTTGGCCACTTTGATGAGAAGCTGCCAAATTATTAAGTAACACCAATGAGTTTATTTCCAGTTAGGATAACTTCAATGTCACTTTGGTGGTCACCCGATGCCGGGTGGAAATGTCGCCACTTTCTTTGCACTACGTAGCAATTACATCCGTTCGCCGCCTTTTCTTCCTGTCTTGTCGCCCCGTCCAGGCTTTCCCCATGCATTGCATGGCCCCAAGGTTCTTTCCTTTGTCTACCCAACATTGACTCACCCGGACGAGCCGACGGAGAGTTGATACGAACCGAAGGTCGAGCCGAGGAGGGCAATCCGACACGGATTTTTTTTTCTCTCTTCTGTTGTTTCAAACACCGCCGTTTCTGATAATGTTGGAAACATATCGAGCTCACGACCACTACTTAATAATCTACTTATACAAATAAGCATATGATGTCAGCTGTTTAGATTTCCCTAGTTTCCTTAGTGCCAGGCCAAAGAGGATATTTCCAACCCTGGCCAGTGCGACGGGCCGGATCACAAATCCACAACCACATGATGATTTGGATAATGAAAGCCCATATTTACAGACTCCGACCTCGGCCGTCGGTTGGTCACGAGTCGAACCCCGTAAATCACGACACGCTTATTTTGTGTTTCGCATCATCGAGAGTGGCTCCCTCCAAGGCTTGCCTATACTGTAATCTCACCTTGCAGTATCTAATCAATCTACTAGTCATTACCTGGCCCACCGTCAATGCCGACAAACCGTGTCAGAGGATCTGATAAAAAATTATCGTTGTTCTTTGTAGAGTTCTATGGATACAAGAGCCCAGCAACGGGGAATTGGAACCTTGTTTCATTGGCAGGTAAATCCACAATAGAAGCTGCAGTTCTATTCTCGGTGCATACAAAGTA
CCACTGGGGTAGGTTCCCTGCTCGTCGTGGACGGTACCTGGCTGCTTGAGCGTCCAAAGATATTCCACCTGCGTGGCGACTTGGCTCTCTTGGTCAGCTT
CTTGGGCCCAAGAGCGACTGGCGGCATTGCTCTTGGTCCCTGCAACACACGGCCAGTAGTCATTTCGATTATACTATCGTCCGATAGAATGCTGGTGTCG
TGACTAGTCATGGTCGGCGAAGTGATCTCTCGTGGCGATCTTGTGTTGATGGGCTTGGGGAGTCGCAAGGCTGACTGGTCTCCGCCGTCCTTGAGTTTTT
GGATGGACCTTCTATAGGCCAACGTAGACCTCATTTCCAAGGCCGGTCCCTCGGAATCGCTGAGGTCTGATGGACGGCGGCTACCAGTTGCTGTGGATGT
TTTGGGAAAGGGTGATGGCCACAAGGTGTTACGGTCGCCTTGAGATGACAGCGAGATATCTGACATATTCCTTGGGACACTTGCCAACAGATTCTGGTCA
CTTTTGGCGGGTCCAATGTTGTTGTTCTGAACAACCTCACCACCAGCGATGACAACGGGCTTGGTACGTTCCAGCAGGAACGGATCGTCGGACAACCTGC
TCTCCAAGCTTTCCTGCGAGGACATTGTGCCGGCGATTCCGCGGCTCAGGCTGCTGCGGCGCCTGTGAGGCATGCCGACACGCCCATAACCTTCGTGTCC
CGTGCCAGCAGCAGGCCCTTTTCGAACAGGCTTTTCCTTCTTTTCGGTAGCCTTTTCGGGGGCCTTTGAAGGTTCATCACCAGCAGTCTTCCGTCGCCCA
AAGAGAAATCGCGTCCTGAAGTTCGTGACGCCGGGGCTGGGACTCCGGCTGGTCGTTGATCCATGGCTGGGTCTACGAGTCTCAACGGTCCGGGGTGCAG
GGGTGGGCTCGCGTCCAAGGGGAAGTTTGGATTGGGGTGGCTGCTGCGAGGGTGTCACAGATCTGGAGCTCTGATAGGCTAGGCTGGCAGTATCGTTGGT
TCCAGGGCTCATTGGCAAGCTCTGGCGCCTCTCGCCGATCGAGGTCGACGAAAGATTGCTTTGGATAATGGGTACCGGCATTCCATACTGCGAGAGCAAA
TCCGGGGTTCCATCTCGACTCGGCCTGATCGGGGGTGTTGCTCTTGGCACGACAGAGGGGCTAGGGGGTTGTATCCTGCTGACAGGGGGCTTCTGCACGC
GTCCTTCTGTTGTCTGTGAGGTCATCATTAGCGGCGCGGGCTGACGAGCTTGCTTCGAAGGAGACGCCTCTAGGCCTCTTTCCTTGTGTTTCTCGGACGA
CGTTCTAGGAGGAGGACTTGGCGGTACTGTGCCGAGTCTTCTCCTGGTCCTCTTTTCGCATTCAGGCTCTCGTTCAAGCTCGGCTTTCCTGTCTCCATCG
CGGACTGTCGAGCCTGATGATGATGAATTGAGTGCTTCCCTAACAGCTGCAAGACCATTAGGGTCAGCGCTCGCCGCACCACCAGTGTCATTTGGTATGC
TTCCGGCTCTCCTCCTTGTGACTGGCGGCCTGGAGCTCTGACCGCCGGCGGGACTGTTCTGCTTCAGTTTAGCTGCAGCAAACCGTCCAGACGCAACGAG
TGCCGGCGAATGCGAGGGGATTGAGGTCGTAGGAGTGGTGTCCCTGCTGTATGGACAAATACCAGGAGAACCAGAGAATCCAGTAGAAGGGCTGCCGCTG
TAGCCGCTGATTTGGCTGCTAGTTCCGGAGAAAAGAGGCGTTGGTGGCGGGAGATCGTGAGTGGAAAGGGGATAGGGAACTTCTATTGAAGAACCGCTAC
CAGCATGGTATGGTCTTGCGCCTCCATAACGATCCAACTCTGGGTAGATCCGTACCGTTTGGGCGTTTGTAGTTGGGAGCTCGACTCGCATCGCAACTTT
GATCTCGGCAGGCGACTCGGTGATGCTCCGGTCGTATTGTGAGCTGTTGAAAGACTCTGGTGACATAACAGAGCGCGGTACAGAGGAAGCAGAGTCATTC
CTTTGTGGGACCATCCTGATTTCTTTGCGATTTTCAACGGCATCTTGGATCATGTTCGAAGACCTTCTTCGCAAAACATTTCGAACCGGTCGCTTCTTTT
CCTCCACGGGCGTAGTGGAAGGACCTGGGACGGATCCAGAGGCTAACCTTGCAGGACCAGAGATGACAGTTTGAGTAGAGCCTGATCCCCAGGACTTGTC
CTGGTGTGTTAATGGTGGCCTTGAGCTCCCTTGCCTGGATGGAGGTTTCCTGGCTGGTCCCTGAGGTATCCTACAAGAGCTTGGCACACCAGTTTGGAAC
CCAAAGGTTTCCATGTCTGGTCGGGTACTCTTGAGGGCAGAACCAGGCCAGTTATCGCCAGAACCTTGTCTGGTTGCATTTGTTGACTTTGAAGAGGCAG
TTTTCGCTGATACGCCCTTTTCCTCAGACCGACCGATCTTTGGGATCGACCCAAATCTGAGAGACGACGACATATCGAGCGTGCGTGCTTGGTAATTATT
AATGGCGGCGGAAGCCGTGTCGTAATCTTAGGGGTATATCACCAATCCATCCTTGCTTTCAAACGCACAAATATTCGCAAAGCCGGCTATGTTCTATGGG
GTGGTCAGCGATCGCCATAGGAAAATGCTGACAATGTTGCACCAAAGAGGTTGTGGGTAGCGGTAATCAAAAGCCTCAAAACCGGCGAAACTAGGCAGAC
GGTATCCAGGGTAGTGTAAACGAAAGGCGCAGTAGATGAGTTGTGCAGGATGACAAGGAAATAGCATCGACTGAGCTCAGCATCCCGGAACCCCCGGCCG
AGTGCCTAGATCTCTTGGAGATGGAAAGGGAAACAAAAGCAGAGAAACATGGGAGACTCAGAACCTTAAAAAGAGATCGAAATTTTCAAATGCAGTTTAT
GGTGTGAATAGTACTTTGGGCAGGGGGCACATCTTTGAACACAATGTAACAGTGAACGGGAAAAGGACACTAACCTAACAGGTTGTTCGCGTATAAGTCT
TTTGGCCTTGGCAAATAGTTGCGACGCTGTGTGGGTGGGACGGAGTGAGATCGGAGGTGATGGTGTGGAACAGGTAGGCAGCGCCTAAGCCTGTGGTTTC
CGCCGGGCAACGAACTGCTTAGCACACCACCACTGTAAGTCGGTTCAAGCTGGTGGACAAAACGGGTGTATTACCGATGGCACCCGAGTGATGGCGGATT
TTAGAAGATGATGATGGATGTGAGGTGAGACACTGCGTCGAGCAGCCAACTTGGATCTAACAAGCAGTCCGAATAATGTATATTTAAACAGGTGAACAAA
TGTATAAAACGAAAATATGTCCTCGTTAGACAACAATGGTCAAGGCAGACGAAAGAAAAGAGAGACAGATGCAGCAATGCAAAGAGCACTGGGATTGCGG
ACAGAGGGATTGAAAAGGAAGATAGGCCTGTAGAGCAAAGTACTCTGAATGGTTAGGCGTATGCATCTCCCACCCACTTAGATCTGGGCGATACATGGCA
AGAAGCTGAGAGGGGGGTGTGTGGCCAAGATGACGATACCCCTCGCCCACCGATGTGGGGGTGAAGAACGGGGGGATCAGCACGGAGTGGACAAGGCAAT
AACCATGTCGATTTTACCAGGCTTCTGGTCTATCACCCCGTTTGCCCGTCCCCAGTCCCGGTCCTGGTTAAGAAAAGGGCGAAGTGCAGATAAAGTCGTC
CAACGAGCGTTGCCTAAACGGCTTCCAGAAAACGGCTTCCAGAGAAACGCCTCGCAACGGAGAGGGCACGGCTCGGCTTGCGGCCAAAAGAAACATTTTC
AAGGTGAAGATGCTTTCTTGCTTCCGCATGCAAGCCAGGCAAGCCCCAAAACCTTGAACAGAGAGAAGAATAAAAGAAAACAACCTCGGCTCTTCACTTG
AAGATTCAACCAGTCGAAAGTCCGCGCGACCAGTGATCTGAGTCACTCTATGCACGAGAGCGGGTTGGCGGGAATAAGTTGATTCAAAATGGATGGCCAA
GGGGAGAAGGTAAAAAGAAGGGAAAATAGAGAAAATTCAATGGATAGCTGTCTAGGAGAATTAATCCCAAAGTAGCATTCAGTACGGCAGGCGAGCCGTT
AAGGCGGGACGAGATTGGACGGCAGAAGCAAGAGCACAGACCTGGGTTATTGCTGCGCCTCCAGAAATAACTGGCAGAGAACGGGTGCGATTTGGGACCC
TTGGTTGTGCATATCGGCGTGCCCTATGGGAGCACAGCATCCTGCTCTCCAGGCTATCATTGGCAACTTCAACCCCCAGAAGCCCACAGTTCGGTACTGG
TGCCACCATCGACACCGTGAAGTAGCCCACCATTGCATGAAGTTTTTTTTTTTTTCGCGTACAGATTGCTGTGTTCGGCAGTCGAGGCAATCCAGTGTAA
TGTTTGGCTGACTGCTGCTTTCTACAAAGTACAGTACATATTTCGATGCGTACTAAGTGCTTTGGGCAGCAAACAGATCGTATTTTTTGTCAGTTGTCAG
TTCTTACTAAAACGCAGACAGGGATTTTGAAGCCATACAGCCTTCGATCCAATGTCACCCATAAATCTGGCAAACAAAAAGGATATTCATTCCTCCCTTC
CAGAAATGACGCTTTCTTGACCGCAATTGCTCGTCTCGTTTCCGCAAACGGTCACGCAGCACGAGAAGGAATCTTGAACAGACGGTGAGGCTTGAACACG
TGCACATGCTGGGCGGCAAGAGGCGCGGATTCACAGCCGATGAATTGCCAGTTCAAGCCTCACCTTTACGCTGCCCCGTTGCCCAGAGACGGGCAGGGTT
GCCCAGAGACGGCAGGGGGGGTGTCGAGTGAGGGAGGGGCAAAGAAAAGGAAATCGCTTGCGTTGTGGGTATTCAAAGAGGTCCCACAAACTCCACCATA
GAAGTCCGACTCCAGCTGCCCGCCTTATCACAGCCCTTCTATAACCTCCCTCACAGGCTCTTCCGCGGCGTGCAATGGGAAGCCACCGCTGCAGGCATGT
GAGACATTGACATCGGATCGGTTCTTTGGATTCGGGTCCGGTCCAACGACAGCCGCAGGAGGCATTTTCGCAGCCTGCAAGTGTTTTGCCAAAGGTTTGG
TTTCCCTTGCGGCATGTCTTAGATTCCTTCTGCGCACGCGCTCTGGGGAAGCACGGCGTCCTTTCCCCGGCGCTCGCCAAAATGACGACCATTCCCATAT
AGGTACTTAAGATATCTGCTGGGTCTGGCGGGTAGCCGGTAGTTGACTGTCCTTATAAAAAAATTCCAGATTGGTCATTTACAAAGTAGCTCGTCAGCTT
AACGGCGCTAGCAAGCCCTAGGGAACATTGCGGCCAGCGCATATGCGTACCTAAATGGCTCGACTTATTATGCGACTATGCTGGTGGGCTAAAAGCCTGG
TCGCATGCCAAAATCAACGTCGCATTACCACATGTTTGAACTTTTAAGCGCGCAGTTTGGTCGGGGTGCTTGTAGTTCCAGCCCCGTGCGAAGCCGTGGA
CACTGGGCAGAACCCAATGGCATTCCCATCTCGGGCCTTTACTTGCGGTACGACAGGGTACTGTGGGGAAGCTTGACGCACCATTGCCGATCTAAAAGAG
TCACCTGTTTGGTTTGGATACTTTGAAATGCAGATTCTTGACGGTGAGAAGGGATTCTTCGTTATGGTTCTCGCTTATTCGCTTAGTTTTGACGCTTGCT
GGCCCCCAAAAAGTCGCAAAAAGAGCGCAATCTGAAGGAGGAGTAAACAAATGAATTGTGGTGGGCTGACAATCAATACCAAGTTCGCGGGAGCCAATGT
TAGTGTCCAAGAAGCACCCCAAACACAGATCCTTGTTTCGCATGTATAGTCTGCATCATCGCCGACTCGTAAATTCCATATCCATTACCGAATGTGGCAC
TACAACACAATTAAGGTAGGTAAGGTAGGTATTAGTTAGGAGAAGATGAAAGGAGATGACCAACTGGTTGTTTGACTCGAAGCAGGCCTGAAGCGACATC
GTTTGAAGGAAGTAGAGATGTGTAGCAGGCCAACAGAATTATTTGATTGGCTAGTCTTTACCAATTTAGAGCCAATCAAAGTCCCCAGTCGTGCGTCTAT
CCTCTCTATGCCCCTGTCTATCGTCCAATATTTCTTGATGAGGGAGGGATGACCCCACCACACTACCATTGCTCTCAGCCAACCAAAGAAGCTCTGTCTT
AATTGACACTGACGATTTTCTTACAGAATTGCTGTACGCAGTATTACTGGACTACTGTATCAGGTAACTGCAAAACTGGGTTCTGAGTAGGTACCTAGGT
AGGTAAGGTAGATAGATACCTAGATTTGACATGAACTTGGTATTAACTGACCCATGTTTACGAACCACAATCACCTTAAACTGACTTATCAAACTTTAGT
CTAATCTAGGTCAACTGTTACTCAACTCGTTTGTTGGTAATAAAGAGCAGGAAATAAGGAGAACATTTTGTTATTACCCCCTGCACCGGACAAAGTAACC
AACCCCTCAACGCCCAACTCCCAAGTTCCACACGCGTAGGGTCTGGAACAAGTTCGAAATGGCGTAAAGAGGGGTTCACAAAAAGCCGCACATCATACAG
TACAAAAGTGATAATCGACAGGTCAGTCAGCATTTCCGCGCGCATACACAAGACTGACTACTGGCTCCCCTTCCAAACAAGAAGAGGGCCTTCGGGTTTG
CACAATGGTACTGTCCCCATGCATACCTGGCACATGTCGTTTATGCAGGAGCGAAACCTGTTTGTGCAGTTGCTCGGCTGTTCCATTGGCGACGAGGAGA
TGGTCTCGGCCCTTCAAAGGAGTCCTAACCATTCAAATCTCAGCCTAAAACGATTCGTATACATGCGTCGCAAATCCTTCAATTTTTTTGTTCTCTAATC
ATATCAGGTCCAATTGTTGTTCCTGACGGGAATATCGAAGATCACGGGGGGGCAACGTCAGCTGATTAGCAAGGGGGTGTAAGGGTATACTCCGTATGCA
ATCAAAGAAGGCACTGCCAACCGCACGCACGCACAGGCTTTTGCCCACTTTTTGGTTTCTCGGTTCTCCCATGCCGGCAGCAACTGCAGCCAAGTATTCT
AAGAAAAGAATTAGACGAGAGCGAGGGACCACATAGGCGGCCAAATCAACGGCCATCTTCGTGTATGTAGGATATGACAGGCAAAAAAAGTTCCTTGTAC
ATGCAGAATGCAAGCCATACTAGTGAAGCCGCGTTATAACATGCCTGCTGCAGGCTGCATCATGCGCTTTTTTGTCTCTGGGAATTCCGAGATCCTAGGC
GAGCTGATGCCTAGAGGTTTTTTTTTTCTTTTTTTCTTTTCTTTTTTTTTCCCCCTTGGGCCAAACGCCACGTCCCAAAGTGGCAAGGCCCGAAAAGTTG
TTAGCCGCCAGTGTATATTTTGTGCCCTTGCTGTGGTTGGCCCTGCACTTCGCCACCGAGGCTCGTGACGTGGCCAACAACGGGCAATAACAAGGCGAGC
AGTAAAAAAAAACCCAGCATCGTCAAAAATCGGAATGTGGCTGAGGCCTCAACCCCCAGGCCTTGCTCTATGTACAATGACATGTCTATCGTCCAAGATG
CAGCCGGCGGCCTCTTTTGCTTACGTAGCACTGAGTAGGCATCTCGTTTTCTCCCTGCATCATCCCATGTTGCTTTAATTGTTTTTTCGCCTGCCAGCTG
TCAATTTGGCCACCTTGTGAACAAGGCCCTGGCCTGCGAACGCAAGCGAGCGACGAGGGAAACCAACGACAAGGCCATTTTTATCTCCATCCTATAATTA
CCTAGAATTCCAAAGCAACACCAATGAGTTGCCAACGACAAATACAATTAAAAAGAGGATCGAAGTTCCATTCTTCTTCACCCCTGCTCACCAGATCAGA
AAAAGAAAAAAAAACTCGCAACCCAATCGCAGGCGCCGAACAGGGGTTCATCTCTAAGCATGGGTGTTTGCCACTGCGATTGGACCGACGGTGAGACCAC
ACAGCGGCAGGGGATCTGGGGACTGGCGTCCGTCGCAATCAACGTGACTCGGAGATGGTGTGTAGCTATCGTAAAATTCCTTTTTTTTTCGTTATTCTGC
TTCTTTGGCTTTTCGGGGATCGTCAAAAGCCGTGTTCAGGGGAAACGGGACGAAGGAGTCGATCTTCTTTGCACTTAAACGGCCGGTTCGTTAAATTATG
TGGCTTTCCAGGTAGGAAGGATATTGAGAGGGTCCGGCATAAGGAAGGATGAGTGTTCGGTATCCGACCTACTAAGGAACAACACCAAGAGCTACCACTA
TCATCCACTTGTTTTCGGCCCAGCTGAGGTCTTTTCAACGCAGGGAATGTCCTTGCCAGAAATCCCCGGATCCCAACGCCCGGCGGATGCAGCCGTTTTT
TTTCTCCTGACTTCAGCTAGGTATAGACCACTCACTTAAAATCCCCCAGTTTTTGAAACTACCAATCGTCTTGTCAGGATCGAGAGCTGGAAGCAATAGG
CATATCCGTCTTGATCTTTCCTGCATATACACCCAAACGGCATGCAGGCATCATGGCTCGAGGCTACTGCACCGGATGTCTGCTTCCTAGCAGGTATAGC
ATCACCATAGTGTGGGTTTTCCTAAACCTGCGACGCAATCAATATTCACGGGGAACATCTGTCGCAAAACGACATGTTTTGTCATATTTCTCGCTTTCTT
CTTTTGTAGGCGTCATATCGGGGGCACGGTCTAGACTTCCGCTGTCTACCAACCATCACATTACAACCCCCTTTTTCCAGCCTTATAGCTGAGCCCACGG
ACCGTTGCTTATCTACTCTAGAACCATCATCACCATCCGTTGCCACACCCAAAAAATCTCACAGCTAGCGATCGAAGTGTGACAGGGCGTTTTGCTTGTC
TTGCTGGGGGTTAGAACTAGGACCAGACCTTTCCTTGTGTGTCCATCTTGGAAACCCTTTTCCCCGATGCCCCAAGCCAGAAAGCCCCTTGTTCCTCCAC
AGGTAATATCACGTCATCTATTTTCCCCTTCATCATGGACCTAGCGGGTTTCCCCCCGCGTTGTAAATAACTGCTGCTCTCTTTTGCAGGCAATAGAATT
TTTCCTCATGGCTGACCGGCTCACCATATCTTGGGGGCCGATCCTTCATGTTCTTTCGACACCGTATGGAGTGATGTGATACGCGCTTTTCTGTGACTGC
CTTGCACTGTCTTTTGCTCCCATAAGCTTGCGCCAATGGCCTATTATCTCGCATTCCCCAGGCATTCCCAGATGTCTACATGTCCGGCAGGAAGATGGCT
TTTTCGTAGCAGCAAGGTCCGAACGTCATCAATTAGTGCTTCCTTGGGGCTTGGCCAGTTGATAGTCATGTGTTTTTTTTTCAGGTTTTCAGTCTCTTAG
GTCCACTCGATCCCTCGGTAATTGCTTACTATGCTTGGGCGTCCGTCCTCAAAAGATTAGCTGGAAGCGGCGCCATCATCGGTTGACGACCAAGGTTTGG
CTCTTTTGCCGGTTGACTAAAAGGCAGACGTAGCTATGACGAAACCAATCTAGACGCCCCTGTAGGAACTCGTTTTTGTGACAAATATTGCAATTGCTTC
ACTGATAGCTCGCTCATATGCTCAAGGCAGTAAACTGCCGAAAAGAAATATGGTGGTTTCTAACAAGAAAGACACTGACGCTATACGAAACCAATGCTGA
GCACACATATATGCTTCGAAAGCCTCTTCTCAACTGGCCCGCCTCCATAGTCCTAGCTGCCGTCCGCTTCGCTCTCTGGATAGTTCAACCAATCGGAAAA
GATCAAGTCAGTCTCAATGCCATCGTTTTCCAAGGCTTCAGTCAGTTCAACTGGTGGCCCAGTGTCTGAAGGGCCAGCCGTAGAGCCATTTAAGTCTCCT
GCCAAGGGAGGTCTGACCGGATGATTAACCGCCTCTAGAGTCGTGATTGAATCCTGCGAGTCTGAGGACTCCACGGCAGAGGAGCCCATGACTGTCGAAA
CACCAGCAGGTCGGTATCCCATGTTGATGGGTGCTGACCACTGCTGAATGTTATCGAGGATTGCTGAAACTTGTCCCACAGGACCAGCTAGCTCTTGCGT
GTCAGACTCTGGACTGCTGGTCACGCCACGAGAGTACTGACAACCAGCACCCAACATCCATGTGGCCTCGCTGATGTTGTGAACAGTGCCAACATGCATT
TCAGGCATAGTTCCATTTGTTCTCCTTGTCAAAGATTGCTTTACCTTTTGCACATTTCGTCTCTTTTCCGACCCTGAATCTTTCGACCCGTCATCCCACA
AGCTGTTGCACTTAGTTGTCGACCTCTCGTCAAGTCTCCGTTGGCTGTCTGGATCGCGACAAAGGAAACCCTTCGTCGATCTGTTGATATCACTATCACG
GCGAGGCAAGTTGGGTGTGGATTCTACATGTGATCTCGTATACGGTTGGAACCGTCTAGGCGCGGGACATTTTGTCCTGGTTGCACCACCTCCATTATGG
GCAGCAGATGAGTATCTGGTACCGAAACCCTCACCAGTAGCTATGCTTCCCTCCAAGGTAACACCGGCCAAAACCGGACGTCCG
CTGTACACAAGATGTT
GATACTCAGTAGTATAATCCGACCACGCCTCCACCTGATGGAAAATCAACCCTGCATGCGGAATCGCAGGCATAGTTTGATGCGTGAGCTAAGCGCATTG
CGTCTGTTGTGCAGCGAC
TTCGCCTTGAATGTCGTTGTTGGGTATTTCCTGCCTTGCACCCTGCTCTTCAGCTTCGTCTCCAGCAGCTGTAGTAGATATC
CCATGTGTGGGTGCTAGGGGCTTATCCGACACTTGATCTTCCCCTTCTGTACTGCTTAC
GTTTTCCGCTTCAGCGGCATCACTAGTAGCAGTAGCAGCAG
CAGCAGCAGCGGCGGCGGCGGCCTCTGCCTCAGCAGCTTCCCGCCTTTGACGTTCAGCCCTGGCCTCCGCTTCAATATGCGCAATATGGCGCTCAGCAAC
ACCAGGGGCGATACTGGCAAGAAAGAGAAGACCAGCCCGCTCCACACGCCGAACCTGATCGAGCAGCCAGTTGGCGTTCGCCTCCCTTCGAGCGGCCACC
ATTCTCTCAGCAGCCTCGCGGGGATCCGGCGCAGCTCGTGCGTTCTGACGATCCGCAGCAGGAGGCACCTGCCCTTGGCGGTTATTTGCACCACCGGGCG
CTGCAGCTGGTGGGACCGCACCTCCTGCCGCATTTGCCTGGGCATGGTCAGCTAATGGGAGGAGGCGTTCCAAATGCTGCCGAACTGGCTGCCATGCATT
CTCTAGCCGACCGTTGAGCAAGCCAGAGTTTATGACGATGATAGCTAAAAGAACCGCGACGACACCACACCAGCGCGTCCATGACCAACCCAAACCGCTT
GTAAACCATAACATAAGCAGCACTAGACGTATCACCAACCACAGATGGGGCCATATGGCCTGGAAAATAGCCGCTGCTCCTTGGGGGTCGGGATGGCGTG
CCCATGGAATTACTCGACGAGCATCCTGCATGCGCCGCAAGGCAAGTTGCTCTTGAACTCGCTCATGCTGCTGCCTGAGCTGTACATATCTTTGCCTAAG
CTCAAATTGCCGTCGTTGACCATCTTGCCGCCACCGCTCCAAAAAGTCAGTGTCTTCTGTTGCTCCAAAGTCGTTCGTGGCGAATGGCTGACTGCTGGCA
GGTTGGACACCACCGACCGGGAAGTGGGCCGTGACCAGATTTGAAAGGGATTCTGTCGGCGTTTCAGCCGAGTTCGTCCCTGTGCTAAGACTCGCAGGCT
GCCCAACTGGTAACGAGGTATAAACGCCACCGTTGTTGAGAAGGACGGCATATGGACCTTCCGGAGAGTTCAAGATATACACTTCAGGTGCAGATGCCTG
AACAGCGCCATTCTGCTGGCTGGAGGTTTGCTGTGACAATTGATTGTGGGGGATCGGAGCCGCCGGGTTTTGCGAGCTGAGCTGAATGTTCATTCGGGCT
GCGTGCACCTGTTCGGCGTTGCCATGGAGTTGTGAGCTAAGCTGATTGATCCGTTCCTGCCGGGCGCGGGTTGCCTGCAGTTGTTCTAGGAACCTAGTTG
CTTGTTCCCTGGCTCGGTTCTCTGCCATGCTTTGCGCAGTCTCACTCCACAACGTATCACTGGAGCTGCCAGATGCTTGCCCAGTTGGGAAAGGGATACT
GCCAAAGCTTGATGTTGTATACCGTGCGGCGCTACCCGTACTCGTCATAGATGGTGGTTCTGCTGGTTGCGAGATCGTGGGTAGCTGAGGGTGCTGATCC
TGTATACCGAGGCTATTCCGGGCTGCTCGCTCTCGCTGGTTCTGTGCAATAATATCGCGGGTGGTGGTGGCCATAGGTTGAGTTGGAGATGTTGTCGACG
GTGACGGCTCCGTTCCTGCAGGAACCATCAGGACGACGTGTAGAACGCGGCGGTTATCAGTGTGAAA
CTATATACAGCCCGAGGGGATCAGTAATTGGAC
ACAAAGATTTGTTTCGCTAGCAGGCTCGTTTGACCAGGAAACCATAC
AGCATCTGCTCCGAAAGCATCTGACAACTTCATATCGGGCTGCGCCAGCATAC
GCCCGTGATAGATCAACCTCATCGCAACAGCATTGCGGTTCGGCAGTGTTAAGTTCATGCGAATCTTGTCCTGTAACTGGGCAATGGTTGTGTGCGCCGG
TAGGTCCGGAAATGTGAGCGGGGCGGGCACACCGACGGACGGCGAAACGATGTCGAGGGTCACGGTGGTGGCATCTGAATTGTTGGCCAT
GATTATTGGA
AGGCGCACACGCGCCGGTGGGTGCAGCCCAAAAGACCCGGTGTCGATACAGTCAAACTGTGAATTCACGGGATGGCGGCGTTGACCAGGGTCGGTCAGCT
TTGGTGGACAATATGGGACCAAGAAAGGTCGGAGGGATTGGTGACCATATGAGAGAACCAGGCAGCGGATGACGTCGATTTATGCGGTAGCAACGTGTGG
TAGTCCAGTCCAGAATTGCAGGCAAGATGAAAGGACTGGAAAGAGATAGACGAGAAGAGGTATCAATAGAGTTACGGTAGACAAAAACAAACACAGACTG
CGATGAAGAGAATAACGAAGAAGAAAAAAGGTCGATGTGGCTTGGATTGATTATTTTTAGCCGTTGAAGGTACAGATTGAACCGTTTCTTGCATGGTTTG
ACTTTCATCCAGCAAGGTGGCCAGACGGAGCTAGATTAATTGGAGCGTCCCGTCTGTCCCGCTGGGTGACTGCCTGCGTCTTTCAAACCTGATACTGACA
GGCGGGGGTTCGGATTACTCGGCGCTGGTTGGTCGCATCGTTATCATCCTTCCGAGAACGGGACGCAACAGTACTTTCTGCGCCTTTCCATAATTCTCTG
TATTTACCTACCTACCGATGTAGGTACATGGGCATCTAAGTTCAAGAGATAATTAAATGAATACATATGGTTACAATAGCTTACAACGTATGAAACTCAA
GTTACTGACAACAAGCCTGACTGTCTGTGGGATTTATTGTATTGAACAGTGCATCATGAAACCGCATAGTCAGAGGGAATACTGACATGACATGTATGCT
AATGCTTGCTAGCTGCATAACTAAAGTTTACCTCAGTACCGCACCATACTACGTACCACGTATATACCTAGGTACCTACCTACCTGCCATGACTGCGGTC
CCTGAGCTTGATCCACTTTTACCATCGGCACTAAGGCAAGCTTTTCAATTGTCATCTCAACACCTCGACTGAGATAAAAACGCATTCAGGTGACGTTGTA
AATTGTGAGGCAAATTCTATCGACTGTCTGATCAGTACCGTAAAAATCCTCAAACTTCGATACCAATTGCTCGACCGCAACCTCAAAGCGAATCACGTGC
GAGAGAGCGCATCGGCAAATCAATCAATCCGCAGGCACGGTGCCACCTAGAACGACCTAGACGTCATTCAGATTTTCCGGGGATGGCCCAAGCGACAACG
TTAGCATAAACGACCAGGGTGTTCCCCTTTATCACGCGATTGTGCCAATTTCCCGCAAGCAACACCACGGGTAGCGGGCGTGGGCGCAAAAAAAAAATTA
ATATACTAGACAACGAATAATCCGTACTCTCCCCCCGCCCTCCCGGACAACCATGGCTTCCACTATAGCCGCCCGTACACGCCTAGTGGCCAGGTCGCGT
CCGATGCACACGTACAGCTCGACATATCTCTACTCCCGCGCGCCACCCCCGAGCCGAGCATGTTTTCCCTCTGGAGGTGCCGGCAGCGGTGCTGGTGGCT
CGCGGTGCTACTCGACCCATGAGACCCCCAAGAGGCCCAAGTTCACCTCGAGGCTGCGCTCTGCATGGAAGAATTCGAAAATCACCTGGTACAATATCCC
GGTCGGAGTCGGCATTGGGTTTTTAGGACTGGTGCAGTTTTATAGGGTACAGAGGAGGGAAAAGGACAGGTTAAAGGATGAGGCCGATGCCGACGCGGAC
AGCCTATCAAGGCCCAAAAAGAGGCAAAGAATCAGGCCAGATGGACCATGGTATGCATTGAGTGCCACTGGTGACAGTCCGGTTAGACCGGATAACTTTG
CGTGGGCACGGTACTGACTGGCAATCTGGATTTCTAGGCAGGTCCAGATCATGTCTACTTTACCCCTGAAAGCACTATCGAGGTTATGGGGCAGATTCAA
TGAGCTCACACTTCCTTATTACCTGAGGATTCCTGGTTTCAAGCTTTACTCTTTCATCTTTGGCGTCAAGTACGTGTCTCCCAAAAAGCTCCTCGCATTC
GTACCTGGGGCTTTACTAACAGCCGGCTCCTCCAAACAGCCTAGATGAGATTGAAGAACAAGACCTCCACAACTTCCCCAACCTAGCATCATTCTTTTAC
CGGACGCTTAAGCCTGGCGCCCGTGTCCTCGACCCCAACCCCCTTGCACTTCTCTCGCCATCAGACGGCCGTGTGCTGCAATACGGCCAGATCGAAGGCG
GTGATATTGAACAGGTCAAGGGCATGACGTACAGCATAGATGCGCTCCTCGGCGAGACTACACCTTCCAGGCCCGGCAGCCTGGCATCCTCTGGCACCAG
CACCCCGAACCCGGCGCAGGACGACGAGATCGTGAAGCAGGACGAAGAGTTTGCCCGCGTCAACGGCATCTCGTACACCTTGCCTAACCTACTGTCCGGT
CCGTCCTCGAAATCCAACAAGACCGACCAGGATCTCGAAGACCAGTCCGTTACGCCGTCGCCGGCGTCAGTCTCCCAGGTCCGCGCCGATTTAGAGCTAG
GCGAGAAGCCGTGGTGGTCTCTCCTGGCCGAGCAGCGTCGCACCAAGCTCTACTACGCCGTCATCTACCTCGCGCCGGGCGACTACCACCGCTTCCACTC
GCCAACTAACTGGGTCGTCGAGCGCCGCCGCCACTTTGCCGGCGAACTGTACTCGGTCTCGCCGTATTTGCAGCGCACGCTGCCGGGGCTCTTCACGCTC
AACGAGCGCGTCGTGCTGCTCGGGCGCTGGCGCTACGGCTTCTTCAGCTACGTGCCCGTCGGCGCCACCAACGTCGGCAGCATCAAGATCAACTTTGACC
GCGAGCTGCGCACAAACTCGCTCACCACCGACACGGCCGCCGACCGCGCCGCCGAGGAGGCCGCGAGGCGCGGCGAGCCCTACAGCGGATATGCCGAGGC
CACGTACGAGAACGCCAGCCGCGTTCTGCACGGCCACGCCCTCAGGAGAGGCGAGGAGATGGGTGGCTTCCAGCTGGGCAGCACCGTCGTGCTGGTGTTT
GAGGCGCCCGCCCCGAGGATGGAGGGCGGGCAGGTCCAGGATGGCTTCGTGTGGGCTGTCGAAAAGGGGCAGACGGTCAAGATGGGACAGGCGTTGGGCA
GGGTTGTCGATGACTTGTAACAAGTGCTGTTCTCGTCATTTCTTGTTGTGTGATAAAAATATTACAAGTCTAATGTTTTCGTGCTCAATTCTGAGTTCTA
TCTTTTTTGTCTCCTTTTCTCAGAAGTATGCTTACTGCCTGGTCTTGCTTTCCGAAATACTGTTATCTACCTGGGCCATGACTGAAGCGATATACACACT
AACAACAGTACTTGTAATGCGCGGTTGTTGTGAATTTAACCGCATGGCCTGCTCCGGCTATTTTTATCACGGAACCACTTGTTGCTGGGATGATTAACCG
CTGCATGTACGGAATCTTTGCCAGGCATTACGCCGATCTTTTGAGGAAGAATCCTTTTGCAACGAATGAAAATTGACAACCCCATGGGGCCAATGATGAC
GTGAGGTGCACATCAGATCTAAGGCTAGCGAATTGCACGTGGTTGGTCTACGCCCTGCAACGACATCCGTGTGATTTGTTGACGAACAGCCTGGATCTAA
TCATTGTCAACTGTTTTTTTTTTGTTTTTTTTTCATTTGTATATCTGGCGCTTTATGCATTTCCAACTCCGCGCTCTGCACGAAAAGACACTACACATGG
AAAAAAGGATTCTAAACCCCCCTCTTCAATAAAATTACCACCCACTATATATACAAAGTATCCCTGTGCGCCCAGCATATTTTTCTTTGGCTCCTTAAGC
ACCAAAGACCTTGACCTTGGTCTCGAGGGGAGCAAACTCCTTGTCGCCGGCGCTGCCGAGCTTGTTGCCAAAGACGAGCTGGGCGTTGAGCTTCCACTCC
TTGGGGATGTTCCAGGTAGTGGCAACCTTCTCGTCGACCAGGGGGTTGTAGTGCTGTAGGCTGGCGCCGACGTTCTCCTGGTCGAGGGCGACCCAGAGGG
CGTACTGGAGCATGGCGTCCGACTGGGTAGCCCAGAGGGGGAACTTGTCGGCGTAGGTGGCGAACTGGGCCTGCATCTTCTCGACGACGGTCTGGTCCTC
GAAGAAGAGGATCTGAAAGAGGGGGAGATGACTTGTCAGCAAGTGCTGCAGTGGAAAATATAGGGAATGATGGGGTGACAAGTTTGTGAATGGGAAGGAG
AGGAAAGGGAAACAGAAGAACTTACAGTACCAGCGGCAGCCTTGAAGCCGTTGTTCCTCGCCTCAGTCTCGGCCCAACCCTCAGCAGGCACGATGGCCTT
GAGGGTCTCGGCGACCAGGTTCCAGAACTTGTCGTGCTCGTCACCGAAAAGGACGACGACGCGGTTGGACTGGCTGTTGAAGGACGAGGGGACGTGCTGG
ACGGCCTCGTTGACGATCTCCTGAATCTTGTCCTTGCCGACGGGGAGGTCCTTGCCGAGGGCGTAGTGGGTGCGGCGCTCCTTGATGAGCTTGATGAGGC
TGTTGGAGGACATTTTGGCGGTTTGTTGTTGGTTTTGAAGAGTGATGACTGGTTGTTCTTGTTGTTGTCTCTGGAAGAAGGCGGGCGTTGAAGAGGTCAA
GAAGCGCTTTGGTAGAGTGGTTCGTACGGACGAGAGAAGCGTGCGGGCGACGGTAGGATTCATATAGAAGACTGCGGAAAGGCAGACCACGAGAGCGAAT
AGTAGATGGCGATGGATGAGGGGTCGGTGGGGAGCACGAGGTGACCGTGGAGCTTCTGCTTTATAGTGGCGGGCAGGATGTTGCATTCTTGTTCGTGGAC
GTATCTAATGGGCAGGGTATCCTCTCTTTTTTGGATTTGTAAATATTACTGAGCACTGGAAATTCGGCCCCGGAGGCTTTAGTTGGACCTAGGAAAGATG
GATGGGGCCCCACGTCAATGCTCAAGGATTTGCCTTCTTGGCCAAAAAAAAGGGACAGTTTGTTGTTGAGAGGTATTTCTATGCGGGAGGATTTGTAACA
GAAACAGGAGAGCGTGTGGTGGAAGAATGGACAGTATCCTAGCCACTTGTCCAAGCTGTCTTGTCTGCAGTCTGTCGTCTGTTGTTATCTCTTTTGTCTT
CACTACCCTGTTGCCGGTGACCTTTTTCGTCGTGTACAATGTCTGATTCTCCACCGCAACCAGTTCCGTCAGTTACAAAATGCCCAATTCAGTCAAAACC
GCGCAGAACTACCCCTCCCCCAACAGGCTTGCTGACAAGGATTGCAAAAGCTTGTGTGTGCTGTGCTGTGGTAAAGTACCTTAGAATGCTTCTTTTGCTC
TGACACTGTTGCCAAGTTTTTTTCTACTAGAATAAGTAGTCTTGTCGTATAACTGTATTACACAATGTGTGATGCCCTGCGTTCTGGACTCCTGATTAGG
GGTCGCTGATGTGCTACCATGGAGACTTGGCATCATTATCCATTTTTCTTTTTCAGCAGCATTGCTTGCTGACCAATCGCACAACATGGAGACGAGACAG
AGTTTAGACATCTCGACCAATCCAAAGCAATGCTCACGGAAGCTCGCGTTTTGTCTCAGTCAGCAGTTTAGCATGTCTGACGGGTAATGACGGTGTAGCC
GATGGGTGATGTTTGTGCTTTCCTAAGCATCGCTAATCAAAGACCCACACGGCTGACAGGACCAAGCTAGCTTGCTTGATGGCTTGCGTAATTAGTCTAC
AAAACATTTTACACCGCAAAACTACAATAGTTTTTACCATTCATGCATTCAGTGGGTTATATTGAAGACAGACAAAAAGACGAAACACGAAATAAAGGTA
GCGATTATGAATGATGATTGAATCTCAGTAGGCACCTGTGAAGATGAGATGAACACTACCTGCCATCCTCACTGCAACTACTTCGTATAACCCACAAGTG
CCCAATACAATCAATCGACGGCAAGAATAGCCGAATAATTCTTACTAGGCGGGCAGTACCTTATAGTGAACGTAAACTTGCCATGTTGAACAACAACTAG
TCTCCCATATATAACTGTGATTTTAATATATCCTCTAGCTACCAACAAAATGGCCTTGCGCCGTGAGGCATGGCAAGCAATTGCTTTAAGTCCATACAAG
TAAATAGCCCCCATGGTTTGTTGCGCCTATCAAACTCCAATGATACGAAAATGTCACGCTCCCTACCGGTTCTATCATCCCATGTTGTGGTACAAGTTAG
TATCGTAGGTGAAAAAGAGTTGCCAAGAAAATATTTCCCAATATGCTGTCCGGTGAAGCAACAACATCAGTGCCAAAAGAGAGACTACCATGTCTCGGCG
ATGTACTGCCCCACCTCCTTCTTCAGGTCCCAAAACTTGTGCGCCTCGTTGCGCCCCAGGTTACCCTTCTCCATTGCAACCTCGACGAGAGCCTCTTCCA
CGCCCTCTCCCATGCCTCTGCTAGAGCCACAGACGAAGACGCGCCCGTCGACCGAGTTGATGATGTACCACACCAGGTCGGCTTGCGCACGCACCTCTTC
CTGCACGTATCGGCCCTCTCCACGCCGGCTCTCTACCACGCGCTTGACCTCGTCTTCGTGAACGCCCCACTCGCCGCTGTAGATCTCGTCCACCAGCGAG
TCGCGTACTCCCTGGAGTACCCACACCTTGTTGGCACAGTTGGCCGTTTTGAGCCGCCGCTGCACAAAGCCTCGGAACGGCGCGATACCCACTCCCGCTC
CGATCAGCAACATAGGCCCGTCCGACATGAACTGTTTGGCCAGCGGGTTGGCCATAAGGCCCTTGAACATGGGGATGTACACCTCGGGGTCGGTGACGCC
GGCTTCCTTGGCCGCAATCCACTTGAGCGCCTGGCGCTGGAAGAAGCCAGAGCCGATGCCAGTCCTTGTGCCGGTGCGCCAGTCGCTGTCAACGTGCACC
GTGACAGCAATTTCAATGATGCGGTGACGCTTGCCGTCCTTCTCCTCAAACGACATGTGGGGGTCGTTGGAGAGGGAGTAGAACCGCGGCATCAGCGGCT
GAAGCACTGACAGCAGCTGGTCCAGAGGGGGCTTGGAGTTAGGGAATGCGTTGAGGAGCTGTACGAGAGAAACGTGCGGTCCTGTCCTGAAGTCGCAGAA
CACTCCTTGGCCCTCGGCCGCGCACAGGAACATGAGAACAGTCTTCTCAACCTCATCCGTGGTGTGCTCCGCTAATATTCTCAACAAATGCTTGGTGGGC
GGGTATGACTGCAGATCCGAGCACCACGACAAAAGAGCCCGCCTGGTAGTGACCAGCTCCCTGGGCTGGTCATCTCCCCATACCGTCGGCCAGCGGCCGT
TGGTAGTACGTAGGATGACGGGCTTGTCGCGCAGGAAACGCGGAATAAGGAGAAGATCTAGGATCTCCTCGACCACGGCAGCATCATTGGGCGCAGAGAC
ACCAATTGCACCACCGACCTTGAAGTCAACGCCTTCGCTGTCTGGGTAATCGGTGATATCGAGGTCAAAGTGAAAAGTGCGCTTCTCGGCGCCCGGGCGT
GTCAACTCACGAGCGCTGTGAATCTTGGCAGGATAGACGTTGTGTGGCGGGTGTGGCTGAACAAATTTTGGTGGTTGAATCCGTGTGTCGGTATCATCTA
GTTCCAAGTTTTGTAGCTTCTTGGCGGCCTCGTCGACTGTCACCTGTTCTGGTTGGGCCCCGGGCTGTGTCTCGGTCTGGCCGTTGCCGCCGAGTGAGAC
ACCAGAGTCTGCGGGTGACGGTGCGGTTTCAATCTCCTTCTTCTGCTTCTTGATCGGCTCAAGAAAAGCTGTTTGCTCGGGCATGTCGGCGACATTTGTC
AATGTGCTGGGGATCGCATCAATCTTAAGAAGCAGCGATTGGAAAGCATCATTCTCGGGTAACCGAGGCTTCTCGAACTGGAGGCTGCCCTTCTTGGCGG
CATTCTTGAAGCAGCACCCGCCACCACAGCATCGGCTGACGACCTCGGCAGTAGACTCGCCAGTGATACGTTGAATGTCGGCGGCGTTCTGGGCAATTAA
ACGCGTTGAAGCGCGACGTCGTCGCGTCTGTGCGAGAGGTTCCTCGAGCTCGTGGTCATCCGTCGAATCGGAGAATGTGAGAGATGGCGCTACCGAAGGG
GTCCGAGGCTCCTCTGGGATGCAGCCCGAAGTGGACTCGGCTAGTATTGTGTCGAGCCTTGACTGCATTGTGAAGGTTAAAATTGAGCGATGTAGTGAAC
TCAGAGGTGATAATAATGCGGGACCAAGTTTGGGTAAAGGGGACGACAGTAGGTGTCGTTGGGTGGCGGAGTGGAAAATTCGTCGTTGGGTGATTTTTCC
TAGTCAATGACCGGCGTGCATTGAGTGTGGGAGGGGTGGTTGAAGAACGAATTGGTGGCTTTGAGTGGTTGGGGATTGGTTATCAGATCTCAAAAGGGGG
ATCAGATAAACATGAAAAAGAAAAGTCCGCCGGCCGGCAAGCCTCAAATGTCTGGGTGGGCAAGTACCAAAGTGGCGGTAGCGAGAAATTTCTCACAACT
TAAAGCAGAGAGGAATTACGACCTTGGGTAAGATGTTGAAATCAATCGTATGACGATTACTCGGCAATTATGAGAAGAAATTAGTTCCTAATTGTCAGGT
ATTTGAGATGCCTACCCGAACTGACCATGACGGATTAATGTTATCAGATCTAGAAAACAGCGAAATGCCATGTTTATTACTGATGCGCCCGTCGGGCTGA
TGAAATACCGCACAATGCTGATCAAAAAAAGAGAAAAAAATAAGTGGGGGTGTACCAAGCCCCTCCCCAGGCCGATAGAGAGGGAGAGCGGAGTTGGAGC
CGAGATCAGGAACCGACCGAGTTCGATTCACACAGCCCTGAAGCCATCAAGCGCCAAAAAGGTTCGATCCAATTCCAACTGGCCAGGACAGGGTCCCTTG
CAACCCTCCTTTTACTTTCAAACCCATCATGCCAAGTTCCAACAGGCCATCTGGGAATTGCTCTGGAAAGGGAAACAAAAAAGAGAGCCAAATTGTTTGT
ATCATAGCGTTTGGCCACTTTGATGAGAAGCTGCCAAATTATTAAGTAACACCAATGAGTTTATTTCCAGTTAGGATAACTTCAATGTCACTTTGGTGGT
CACCCGATGCCGGGTGGAAATGTCGCCACTTTCTTTGCACTACGTAGCAATTACATCCGTTCGCCGCCTTTTCTTCCTGTCTTGTCGCCCCGTCCAGGCT
TTCCCCATGCATTGCATGGCCCCAAGGTTCTTTCCTTTGTCTACCCAACATTGACTCACCCGGACGAGCCGACGGAGAGTTGATACGAACCGAAGGTCGA
GCCGAGGAGGGCAATCCGACACGGATTTTTTTTTCTCTCTTCTGTTGTTTCAAACACCGCCGTTTCTGATAATGTTGGAAACATATCGAGCTCACGACCA
CTACTTAATAATCTACTTATACAAATAAGCATATGATGTCAGCTGTTTAGATTTCCCTAGTTTCCTTAGTGCCAGGCCAAAGAGGATATTTCCAACCCTG
GCCAGTGCGACGGGCCGGATCACAAATCCACAACCACATGATGATTTGGATAATGAAAGCCCATATTTACAGACTCCGACCTCGGCCGTCGGTTGGTCAC
GAGTCGAACCCCGTAAATCACGACACGCTTATTTTGTGTTTCGCATCATCGAGAGTGGCTCCCTCCAAGGCTTGCCTATACTGTAATCTCACCTTGCAGT
ATCTAATCAATCTACTAGTCATTACCTGGCCCACCGTCAATGCCGACAAACCGTGTCAGAGGATCTGATAAAAAATTATCGTTGTTCTTTGTAGAGTTCT
Copyright 2006 Fungal Plant Pathology Lab. & FBL
E-mail : yonglee@snu.ac.kr
Magnaporthe oryzae ATMT Database