Home   Guide to ATMT Database   Sitemap   Contact  
Sequence ID  5330523
Locus Name  MGG_06772.5
Gene Name  
Protein Name  hypothetical protein
Species Name  Magnaporthe grisea [Magnaporthe oryzae 5 PROTEINS]
Protein Sequence
[140 aa]
+  1
101

MVETQTPYVRTIIRHHDAHRANHSAPALAWSDSLAGTAQSIAETCANYTWYGSEPDLVDFSRWGHFSQLIWTSTAEVGCATVDCSSRQCGLQNVQGQPPYFTVCNYKPPGAPLGSPSIDGTFMCGSSINFSYSLVFGSRL

DNA Sequence
[423 bp]
+  1
101
201
301
401
ATGGTCGAAACCCAGACCCCCTACGTCCGCACAATCATCCGTCACCACGACGCCCACCGTGCAAACCACAGCGCCCCGGCCCTGGCCTGGTCCGACTCCCTCGCCGGCACCGCGCAGTCCATCGCCGAAACGTGTGCTAACTACACGTGGTACGGCAGCGAGCCTGATCTCGTCGACTTTAGCCGCTGGGGCCACTTTTCTCAACTGATCTGGACGTCGACGGCGGAGGTGGGCTGCGCGACCGTGGACTGCTCTTCGCGTCAGTGCGGGCTCCAAAACGTACAGGGCCAGCCGCCGTACTTTACCGTGTGCAACTACAAGCCGCCAGGCGCACCGCTTGGCTCCCCGAGTATCGATGGCACTTTTATGTGCGGAAGCAGCATCAATTTCAGCTATAGCCTTGTTTTTGGGTCGCGGTTGTAA
TCGCCGGCACCGCGCAGTCCATCGCCGAAACGTGTGCTAACTACACGTGGTACGGCAGCGAGCCTGATCTCGTCGACTTTAGCCGCTGGGGCCACTTTTC
TCAACTGATCTGGACGTCGACGGCGGAGGTGGGCTGCGCGACCGTGGACTGCTCTTCGCGTCAGTGCGGGCTCCAAAACGTACAGGGCCAGCCGCCGTAC
TTTACCGTGTGCAACTACAAGCCGCCAGGCGCACCGCTTGGCTCCCCGAGTATCGATGGCACTTTTATGTGCGGAAGCAGCATCAATTTCAGCTATAGCC
Position in Contig 2048664 ~ 2049204 (541 bp, 118 bp) in Magnaporthe grisea 70-15 supercontig 5.186 (Strand +) (Frame : 3)
Chromosome Chromosome : Not defined!
Contig Sequence
(2038601 ~ 2059200)

+2038601
2038701
2038801
2038901
2039001
2039101
2039201
2039301
2039401
2039501
2039601
2039701
2039801
2039901
2040001
2040101
2040201
2040301
2040401
2040501
2040601
2040701
2040801
2040901
2041001
2041101
2041201
2041301
2041401
2041501
2041601
2041701
2041801
2041901
2042001
2042101
2042201
2042301
2042401
2042501
2042601
2042701
2042801
2042901
2043001
2043101
2043201
2043301
2043401
2043501
2043601
2043701
2043801
2043901
2044001
2044101
2044201
2044301
2044401
2044501
2044601
2044701
2044801
2044901
2045001
2045101
2045201
2045301
2045401
2045501
2045601
2045701
2045801
2045901
2046001
2046101
2046201
2046301
2046401
2046501
2046601
2046701
2046801
2046901
2047001
2047101
2047201
2047301
2047401
2047501
2047601
2047701
2047801
2047901
2048001
2048101
2048201
2048301
2048401
2048501
2048601
2048701
2048801
2048901
2049001
2049101
2049201
2049301
2049401
2049501
2049601
2049701
2049801
2049901
2050001
2050101
2050201
2050301
2050401
2050501
2050601
2050701
2050801
2050901
2051001
2051101
2051201
2051301
2051401
2051501
2051601
2051701
2051801
2051901
2052001
2052101
2052201
2052301
2052401
2052501
2052601
2052701
2052801
2052901
2053001
2053101
2053201
2053301
2053401
2053501
2053601
2053701
2053801
2053901
2054001
2054101
2054201
2054301
2054401
2054501
2054601
2054701
2054801
2054901
2055001
2055101
2055201
2055301
2055401
2055501
2055601
2055701
2055801
2055901
2056001
2056101
2056201
2056301
2056401
2056501
2056601
2056701
2056801
2056901
2057001
2057101
2057201
2057301
2057401
2057501
2057601
2057701
2057801
2057901
2058001
2058101
2058201
2058301
2058401
2058501
2058601
2058701
2058801
2058901
2059001
2059101
CATTAGTGATGAAGATGTCAGGGTTCTTTGGTACGCCTCAGAAGCCCCTAGGGCCAATGGAACTCAACATCTATGGGACGGGGTGCAGTACTACTGCATT
CGGCGTCGGTTAGACGCTGCCCAGGCCATTGAATAATATACAACAGGTGTTCCAGTCAAGGCGTTGGACTATCAAACAGGAAATTTTCACCATTTCGATC
TTGATACTCATCCGACTGACACGGAATGCGGCCCCCTGCCATCCGAAGCGTTATCATGCATCATATACAAGTTATCATTAGGAGGTTGTCTGTCTAAAGCTGCTTCCATCTACGACAGGAGCGACAGCATCGGCAGCTTGTAAACTGTCACGTTGGCTTGGTACTGGCGGCAACTTTGTCCGGTCCGCGTCACTGCCGGCACGCTCATGTGATTTGGGCTCTTCAACACTACCCAGCCTCTGCCTCGCTGCAGACACGCCGCTTCCCATGCCCATGCCCTCTAGCGACATCCACTGCGCCTGTCTTTCGCCTCTCTCGGCACGCAGCTTCTCGGCCTCGTCTGGCTCGTAATCGGGCCCAGGGGCTCCCCATGGATCGGCATAGTGAGTTCCTTTCCGTCGTGGAACTGGCTTCCTCCTTGGCCGGCTCCCATCGGTGCTGATTTTGTGTCTTTGACGTCTACCTGGCGTCGCTGCTGCAGGAGAAGTCGACGGCGATGACACTGGTGACATGTTTCGACCCGCCGGCATTCCTACGGTGACAGGTGAAGCATGATCTCGAAACCCATCTGCCGCCAAGGCCGTTGCGACCGCCATTGTTTCTGGGGATGGCGCATCGGCCGTGGCAACGTGTGGGCTTGGAGTCCAGGGTGGTGCATCACCGCGGTCCATTTCTGTGTTCAACGTTGGCAGCACAGGATGACTTGTACTCGGAGAGTTAGCTGTGTTTGGAGGCAATGTAGGCGATATTGCTCTCTGTGCTGACTCAACGTCGGGGCTGAGTGGCGTCATTGCCGTTTGTGTCGTGCTCTGGAAGGCAGCACTGCTTCGGACGTTCATCTCGACATCACGAGTATCGGCCTCATGCGTTGGTCGTGGGGCGCGCCGTCCTGGCAGAACAACGACGGGCTCTCCAGTAATCAGGTACATTATACGAGGTGTTGAACCCATAAAGGCATTATCGATACAACCGCGTATGGAAAGTATAAAGTGGAAAAGACTGTTTCACATCACTTGGGTTAGTTGGACTTGATGCGATTGACCCAGGGGGGGTTGATTACTGACCTTGACAATGCAGTTAGGGGTATCGCCGCCTGATAATACGCCAGGTCTGCGTAATTGTGAAGAAATAAAATAAATATTTGGTACCCAACAGCAGCCAAGGCAAGGAGAAATATGAACGCGTCGAGGAATATATGGGCCTTGGCGGAGATTCCGCGGCCTTTGCGGAAACACATGGTGATAAACTCGGCACTGTTCCAACTCATGATCACAGCGGCCTTGTGGGATACGTCACGTTAGCCTATGTCCCTCCCTCACAAGCATTGCTGTACAACTGGCCGGGTTGACATCCTGTCGGGAACACTTACAAGCACGTATTGGAGGACGTCGTTAATAAATGACCATATATCCGGATAGGAAATAGACATCCAGGGTTGCCGGTTAATTTGTACCGGCACCATGGTCACAGCAAAACCCGTGGTCGACACCCTCAAAACAACCTTTGCTATGTACCATCCGTTGATAACCGGCTTATCAAGAGCCTCCAATTCTTCGCGAGGCAGCCGTGAGCGGGGGTCCATCCCCGGATCCGTCTGTTTGCTTGCATCAGCACTGGACGATTGCGTCGACAGCTGCGGCCTTGTTGGTGTTGCTGCTGCCGGAGCCAAGCTGCTAAATCCCCGTGCCATGTCGCTAACCGCTGTGTTCTCCGAGGACGGCAACACAGGAGCCGTGGCCCGCGCCCCCATGATTGCTCTCATTGTCTTTCTCATGGTGGCATCTAGGCCATTGGCGGGTCAGTTTGGGCCTATGACTGAAGATCGACCGATTCTTCAAGCGGTTCATGCCATGCCCTTGATGCAACCGTGATATTCACAATGCGCAGTTGTGGCACATAGGCCATCCAAACAACCGTCGACGCGACCGACAGTTGAATGGCGGAAGGGCGCCCCGTTGGACGCGACAGACAACTGGCCGCCACCGCCGATTGGCTCCGTCAATCCAATGAGGAGAAGGGACTCCCAAGCTGAAACCTCCAATGGCCCGTCTCCAGAAAAGGCTGCTGAGAGGTCAACAACCAACTGGCGGCGTAGTCTGTGCTGCGTCAGCAACTGGTACTTGTGGTGACAGTTTGAGTGCGACTGCATGGAGCAGAGACAAATGTACGAAATTACAAAGTACAAACAGCAAATTGGTCAGGCTGCGGAGGGGGGACACGGGGGGAGCGCTTGAGCGAACCGAACTCGCGGTTCCAGGCAGCAGTTTAAAGTGCTTGGCGAACAGGGGTTTGAATGGAGATTTTGACTGACAAGTCGTCCATCAGGATCTGGACATAATCACGCTTGTGTCTCCTCCTTTGCCCTCTTCGACAATGCGCACGGCATGCCATTCTACTTCGTACAATCCACTACCTGACTTTAAGCTTACTTTGGAAACATACTGAGTCCCCTAGTTGGTGCAAAACACGGCACCGAAAACTTTCAAGATGGAGGCCCACCCATGCATTTTCTGAAGTAACACCAACAGTCACTAACTTCTTCTGTCGTATTTGGCTATGCCCACATTCAGCTAGTCTGTGTTTTGGTTTGGATAACATGGACATATGGAATTTATGATCAATAAAGGAGAGAATGGCCACCAAGCCAAAAACTGACGTATCCAACATCTCCACCGCAGAAGAGAAGGCTATAGAAACAGAAAAAAAAAGGTCGATCAAGGAGCGTCGAGAATCTAAAAACTAAAATTCCACGTTGGCTGCTTTCAAAAAGAGGGGAAACAGTCAACTTATTACCAATAACCAACCATACCACAGTCTATTCCTTTTCACGAAAGCTTCCTTCCCCTGAAATCCCACGCCAAACAGCCTCCCCTTTCAACAACATCGACTAGGCCTCACAACCTAGCAAAGATCTTAAGCAAGGACAACGTTACGCTTCGCCCAGCGCTTGTACCCGTACCCGGGGTAGCCACCGTATCCGGGCGGGCTCCAGGGGGTGGTCGTGGCGGCCTGCGAGGTCGAGGTCGAGGAACCCGGTCCGTAGCCTGTGGTGGTGGTCACAGCGTCGGAGCTGGTGCTGCTGGTGCTACCAATGGGCTCGGCAGCCGACGTCTGGGTCACAAAGGTGCTCGGCGATGTGGTCGGAATGGGCGGGTAGCCGCCGCCGCTGCTCGTTGCCGGGGGCTGCGACTCCGTGATGGACGACGGGCCGTACGACGAGGAAGCGCTGCCGGTGGCTGTGGTGTAGTAGGTGGATGACTCGCTGCCAGTCTCGGTGCTGCTGGCTGCGGAGGAAGTGGCCGAGGAGACTGGCAGAGCCCCAGAGGTCTCCGATCCGCCTGTGGTAGTGGGAGGACCATAGCCACCGCCAGTCGTGGATGGAGAGCCTGATGCGGTTGTCGAAGACTCGCTAGAGGCGCTGGTGCTGCTGCTGTAGCCTGCGGAGGAAGTGGCCGAGGAGACTGGCAGGGCACCCGAGGTCTCTGATCCGCCTGTGGTAGTAGAAGAGCCGTAGCCGCCACCAGTCGTGGATGAAGAGCCTGATGCGGTCGTTGGGGACTCGCTAGTGGAGGAGGTGGTGGTGCTGCCTCCGTAGCTGGTGGCAGGCGAAGTGGCGGCCGTCGTTGAAGTCTCAACTCCGGTAGAGCCGGTTCCGTACGTGGAAGACGCGGCGCTGCTGCTGATGCTCGTGGCACCGGTCTCAGTAACCGAGGTCCCGGAGCTGGCGGGACCGGTTGTGGTGCCGGTGGTAGTGGTGCGTTTAGTGCACTTTGTCTTGGTGGACGTCAGGTCCGTCGACGACTCGGTGCTCACAGTGCCGTAAGTCGCCGAGGTAGCAGGCCCAGTCGAGGTCCCGGTGCTGCTGATAGCATCTGTAGCGGACGTCTCAGGTCCAGTCGGCGTCAACGTTGAGCTGATGCCGTATGTCGCGGAAGTGTCAGGGCCAGTCGAGGTTCCGACGCTGCTTGTTTCAGAGGTGGCAGAAGTGTCAGGACCGGTGGACGTTCCCGTGGTGCTGGTACCGTACGTAGCAGACGTCTCGGGGCCGGTAGGGGTGCCAGTATAGCTTATTCCGTAGGTTGCCGAGGTCTCAGTGCCTGTAGTCGTGCCCGTGCTGACAGTCTCGTACGAGCTGGAAGTGCCGGGCGTGGTCTCGGGGCTGGTCGAGGTGCCTCCGCTCTCAGTCGCCGACGTGGTCACATCGGTCGTGCTGGCTGTCGTGCTGGCTGTCGTGCTGCCGGTCTCCTGTGTCGACGATGCTGTCTTGGTGACGGTGCCAGTTGCCGTGATGGTGATGCGGGTGGTGATGTCAGTTGAGCTGGTGCCGTACGTCGATGTCTCTGAAGTCGCGGGCGATGTTCCAGAGGTCTCAGTGGTGCCGGGGACTGTCTCGCTTGTCTCCGTAGAAGAGCTGGCTGACGTGACGCTTGACGAGCTGTAAGACGGCGATATAGGCAGGTTTGAGCTCACAGTGATGTCAGAGCTAGTGGATGACGTGCTCGGGGCTTCACTGCTGGAAGACCCAGACTGGCAGCCATATCCGTAGCAGCTGGTCACGGGCGGTGCGGTTGTGCTGCTTCCCGGAGGACTGGTCGACACTGACGTCTCGGTGGGAGGGGAACCAGAATCAGACGGGCTGTAGGTGCTTGTGCTCTCTGGCGGAGGCAGAGTCGTCGAGGATTCGTAGCTGCTCGAAGAAGCGTCGGTTGTCGGGGGTGACGTCTCGCTGGTCTCAGGAGGCGCGGTCGAGGACCTAGACGACGACACGTTGCTCGTGGCAGATGTCTCGGTCGTGCCTGGAGCCGTGCTTGAGACCGAGCTCTCAGGACCAGTTGACGACGGGGGAGGCCCATACGAACCGCTGGAGGTGGGCGGGGCGCTGCTCGAGGAATCAGGCGGAGGAGCCGAAGTAGTGCCCGGGGGAGGTCCGTAGGTGCTCGAGCCTGACGGCTGATCGGTGCTCGTAGTTGCCGGGGGTGGGATGCTGCTGGATCCAGGAGGGCTACTAGTCTCCGGTGGCTGGGACTCGGAAGAGGTCGGAGGCCCGTAGGTGGCAGACGTGCCAGGCGGGAGTGTCTCGGTAGTCTCTGGCGGCGCGGTGCTGGTGCTGTAGCTCGATGAGGCGGACTGGCTGATTGCATCAGTACGAGACGTCTCGATGGTGCTACCAGGAGTGGTGGTGCCCGACGGTGGGAGCGTCGGGGTCTCCGTATCAGACGACAGAGTCGAGGTCGGAGGGCCTGGAAAGCACGTCGAGGCGCACGCCGTCACGGTCACGGTGGTGGTCACAGTGCCGTAGTTGTAACCTTGCGGCACAGCCTGTACCAGGCCAGAGCTGTATTGTGAGTAAAGGAAGATATAGTGTCAGCACAGAGGAAGAGGACCCTAGTTGTCTTCGGCTCGCCCGGGCGCTTGTTGGTGCTTGTTTCTGGCGTACTTGTGGTTGGCAGTACATGTATTTGGGAAGGACAAGCTTATCCTAACCCCGACACATGGTTCACCACAAGCGCAAAGGCAAAAATCAAGACAAGAGGAGGAAACGTGAAGCAGGAGTTGGAGAAAAGGTTGGAACATACCCCAAGCCCATAAGGGCCATCCGAGTGAGACCGCGCATGCTGGCTACAAGACCAGGTGTGGGCAATGAATAAACGAGTGTTATAAGAGCGAGCGTAGGTGGGGATGACAGTAAGACTTCCTACAGACAAACACCAGTGACGGACCCCTTGGTGAGAGTGACAGTGGCCGGAGGGTTGGAGAGAAGCTCGAGAGTATCAAGAATCCTCTGGTCCTGTCTCTCAAAAGGAGCTGTGTTCTCCTGCCATGGGGAAGAGGAAGCCTTGGGGGGGGGTTTTATAGCATCCCATGTCGCCTACTCGGATATGCCGACTTGGCTTTGTCAGACGGATATGGGCTCCTTTTGCCCCGTCCGGTACATTGACATGTCCTTCTCGAATAGATAGATACACATGCACCATACCTTGCTCACCTTGCGTGAACTGGTGGCTCCCGAACCAGCCACGCGAGGCCATGCATCTTTCGATCATGGCCACACCCCCCATGTACACCTGCCCTGGCATCTGCAACAAAGGCTCGCGTGAGACGGCGTATTCTGGGCTTGCATGGAGAAATTATCAGTCAGTCAGTCAGCCTCCAAGATCGGGCTTTCCTTCTAGGTACGTCAGTCAGTCGTTGACGTGCCTTGATGAGCTTGGCCCCATAGCAAGCCTATTTGTTGAAGAGCGCATTTGTGTCTTGGCCCGGACATTGGGCCTGGACTCGTCGGGATCTACTTCAGCTTTCGATAGGAACCGGAGACGGGTAGGCACGCCTCGGCCTGCAGGGATTAATGCCGTCCAGAGGTTATCCCGCCAGACAGCTATCATCAATCTTGATCTTGATCTCCGAGGCTTTCCAGCCTGTCCCGTGGGCTGAGGCCCTTCCCGTGGTGGCGTCTGCACCAACGAGGTTAGGTATTGGGCAGGGTCACCTCAATCTTCATAATCTTGCCAGTACTTTCATTATCTGTGGTCATGACTTTGCTTGTTTAATATGAGCAGAGCGAGGAAAAAGAGAAAAAATAAAAATTCGTAACTACTCAACTAAAGGTAAACTCACCTCCAGGAACACTTCACTATGGGATTGAATGAAAGGAACTCACCTATTCGATCTGATCACAAAAGTCCACCGGCGTGACAAGCACAAGGCTCCCTCCCTCTCGCCCAAACTCGGCCTGCCCATCTGAACCCCATGTTGTATGCGGGTGGCACCCATCTATGGTCCGCAAACGGGTGAACCGGAAAGCAAGCTTTATTCAATGTCGTGCCCGTGCAACGTCTGGGCCAGCATGGGGGTCAACACAGAGGGTATGTTTGTCTTGCCATGAGAGTCAGGAAGCCAACCATTATTCGGGACTGGGACGGCCGAGCTCACACTTTATCCGCCCGTTGTTTGCTTGTTGCGCAAGACATGTGTCGTCAATTTTGTCTGACCAGACCACCAAGATGGTTTATTGTGAGACCAAAAATCATGACCTTACTGACCTTGGTGTGCTATAGCTTGCCCAGCCGTGACGCTGCAGAAAGACACCAACTGACCATTCTATGGACTCTCGATCTTTTGTTGGGCTGGCCTTGAAGGCCAGGAAAGAGTAAGTATACGAGCACCCTGCTGTCCGCTTCACCTGGTCCGGATGTTACCTCATGAGCCGGGTGGACCGCGGTCCTCGTACCACACGGATCTAGGTAGAAGTTCTTGTAGCACAAGCTGAGTGCCTTGATTTACAACACGTCGTTGCTATTGCAGCCCTAGAGGCTATTGGTTATAACAGTTTCAGTAGAGTCGCTGTCTTAACGACTGTACACTGGTCTGCAAGACGGCAAATACTGCCGTAGTTGAAGCTATGATGAACGAAGCTCCGATGGACTGACTGGTACGAGGCTGAGGCTGCGTTGATGATCGACGTTCTTACCAGAAGCTGATGATCGATCTTGGTTCATCGAGTGGAATCATCCTTAGGATGGGGCTATCAAAAGCATGTGAATGCTAGTCTGCTAAGCCAGGTGACACCGATCTTCTATTTTCTGGCTTCTCAGCTTTGACCGTACCTGCAGTGGCTGGGCTGTGAGTATCCGTGAGGGGAAAGGGAAGGGCAAGAATTAGCCTGCAACAGTCCGAGCACAAAGCATTTGATAATTTCCCGGCGTTGCAGACAAATTGACAATGCCCCCCAGGCATTCTGGGAGCGATCAATAGTTCCGAATGGACGCCGCTTGCGTTTCTGTCTGGCAGATGAAAATATCTGGCGTATAATAATTGATTGGCGAGTGCATATGTTGCTCAGAATCTGCAACTCAAAGTCAGAAGTGCCTTTCTGACCATTTCGTGTATAGCTCAATGGTTTGCTAGTGACGATGGCGATTGGAATGCATGATGACATTGGCTGATGCTGATGTAGCCATGGCATTTTGAACTTGTTCACCAGTCGTATCTGGGACAAAATAATTTCTGCTTTTCAGACCAGAAGCACGGAAAAACAGGTCATGTATTGAATGTAAAATCGACAGCAGTTGTTTGCGGAAATTCCTGTTGATAGTCCGTCCGCTGACTTGGAGATGTCCTCACCCGAGACTCTTCGACGGGAAGCCAAGCTGAAAAACAGGTCGAGGTTTGGTAGTGGACTGAGGACAACAGAAGGTACCCAGTGGGCAGTACCTTTTCACATCTGCAGCTGATTCCCTAGGTACCCTAGGATCTGGCCTGGATCTGGAGAATTGAGACATGTTTTCCGAGTTTGAGCAACCCACCCACCCTTTCGCATGCACCTGCTGGTCGCACGCATTTGCTGACCAAGAAAAGGTTGGCCCATCTACCATGGCAAGGTCAACCAACACGAGCAGTCGTGTCACAGTGGCGTCTCCAAGATGGAAAGAAGGACTGGAGGGTTGGCAATCGTATTCTCCGCCACTTGCAGCTAAGGTACCTTCCGTCCTGAATTTGCTATCGATTGCTGTTTTGCCCCTGAACTAGTAACGACGCCACAAATGAGTGGTTTCTGCAGCCTTTGTTTCGGACTTTTAGAATCCTTTGGCTTCATTCAATTTTCACGAAAAAAAAGCCACAGCCATTTGGGGCACAAAATCGCCGCTTAGGATGGAAGAAAGCAGTGTACACTGCAGCTCCTCATATCAACTTTTGCCCACCGTTAAGTCTGCTACTTCACGGTGCACATTTCGGCGAAGGTGGTCTGTCTCACAATCTGATATTTAATAACTTTCAGACATCTAATCTCATATCATATCATATACCTTCTCTGGGCCACACAACTTGCTCAACCACAATCTGCAAGTGCCATTTCGCTTCAGAAAAAAAAAGAAGAAGAAAACAAAAGAAATCCACAAACTCTAGAGATTGCAAAGACGCAGAGACTGACGATTAATGTTCAAATACAACGTAGGCATGTACAACCTCGTTCCGAAAACCTGCCTAAGGAGGTCCAGTTGCTTGGCATTGAGCTACTGCTTCACACTGCCTCTAGAACTAGCAACCAAGTAATGCCAGGCATCGTGGAACTGTTGGGGACATCTGAGCTCGTAAACCCTCCCTAATCCAATATTTCTCTTCTGAAGCTGACACATATGACAGTGGAGACGAACGTCTTAGCGAGCACATACTCATCGTCAATGAGACGCTCTATCAAACCTACAAACTGTCATGAGCTCACTTTATATTGGTCCTTTCGCGGGCGAACGCGCGATCAAAGTCTATGGACTAGGCTAGGTACATACATACATGCATATCGAGACATTCGAACTTGGCCCTCATCTACCTTCCTACGTTCATTCCCTTCAATCCACAAATGCGAGAGGTACATGCTGGAAATCGCATTGGGAAAATTGTGACTCCGCCAGGATTGCTTCCTGGCGAATATCTTACCGGAGTAGAATATACCGTGAAATCTTGCTATTAGGTTGCCATCAACATGCTCTTCTCGACGCTCTTTTCACTGTGTTCCCTGGATACTCAAAGGTTATTTGTACTTGGTACTTTCATTTCCTTGGCTTTCTCACTAACTTCAGCTCAGGATAAAGATGGCTGTTGGTTCCGCGAGGATCCCAACTCGGCCGCTGACGATGTCGTCTTACGCCTCTTGGTGACAACTGGGTCCCTTCTAGCATGTGCCTCCAGGCATTGGTGGGTTTCCTACCAGCACCAGCGCAAGCCCGTCGACTTTGCCGCCATCATCTGTGACTGTGATAGTTTCAGTAACCTCCGTGACGACAAGCACGGCGCTTACCACGAGCACCACTATTACCGCTACCACCTCGAGCACAATCACAACATCCACCTCCACCACAACCAACACCATGGTCGAAACCCAGACCCCCTACGTCCGCACAATCATCCGTCACCACGACGCCCACCGTGCAAACCACAGCGCCCCGGCCCTGGCCTGGTCCGACTCCCTCGCCGGCACCGCGCAGTCCATCGCCGAAACGTGCATCTTCCAGCACAACACAACGGCGGACAGCGGCGATTACGGGCAAAACATTGTAGCCGGCGTGCCGGAAAACCAGATGGGCATCGTGGTGACGGACACGTTCTACAACCCCTAGGTGTGCTAACTACACGTGGTACGGCAGCGAGCCTGATCTCGTCGACTTTAGCCGCTGGGGCCACTTTTCTCAACTGATCTGGACGTCGACGGCGGAGGTGGGCTGCGCGACCGTGGACTGCTCTTCGCGTCAGTGCGGGCTCCAAAACGTACAGGGCCAGCCGCCGTACTTTACCGTGTGCAACTACAAGCCGCCAGGCGCACCGCTTGGCTCCCCGAGTATCGATGGCACTTTTATGTGCGGAAGCAGCATCAATTTCAGCTATAGCCTTGTTTTTGGGTCGCGGTTGTAATTACAGTCCTCATTGTGGAATGGTCACAATGTGTAGGCTGTATTTTTATCAAGAATCATGGCCAGGAAACGGCGCTTGCCAAGAGAAAGGAATTGTTCCCTGGATGAAAGCCACTGAAGATGCTAGTAGACTTGTAATCTTGGCACCTGGGTAGCTAGCACGGTAGCTGGAGCTTGATCTGTTGCTCTTGGTCGCCATTCCAGTCACAAAGCAGGCGACCAAGAAAAAAAAACACGAGGCTTGGCTTTTGAAGTCGTGAAAACAAGCCTTTGCGGCGGTTGATCTACCTATTACCAAAACTTAACGCAATATTGTTTTTATTTCAGCCTATGACTGGCACTTGACGAATTTGATAAAGAAAGCAATCATTAACACCCTACTCAGCCCTGCGAAATTGTATCCCACAGCCTCAAAAGGACCCCTGAACCGTGCTTACATTCAATTCAGTCTGTTAGGCAGCCCAGGGGCGACTTCAATATCACATCACTAAATCGTCTGTTCCAACCCAATCACAAAGCGAGCAGGACTCAGATTGCGGCATCCGACTGCAAGCTAGAGCGACTCCTGCAATGACAGCGGTGATCCGGAAGTTGCCATCAGGCCACAAGTGCTAGCTGAAGTACCGAGCCCTATGACTAAAATAAGTAGTCGGGTTTTGGTTCAAGTAACATCTGAGCGCAAATAGAGAGTGTCAAACCTGTCTGTCTCGCGTTCACCTTAGACTCCCTTCCCAACAAAATACAGGGTCTACTAGCTGCTAAGCGCACAAACAGAGCTCCATCTTGATCACAGAAAGTCGACGGGGTCTGGAATTCTCGTCCTCAACCATTCGCCCACCCAAGAACGCTATGTTCCCCAACCCGCCAAAATCTGGGTCTTTCAGCTGAGCGTTAGGGCCGTTACAGAAGGCGATATTATCACGCCTTTTGCAAGATATACACTATTGTTTGTTGCTCGATTCTATGGGAGGATCCGGTTGGTGTCTTGGCAAGAAACAGAAAAACGAGTATAAGACAACGGTAGAAGACTTGGCGATCTCTTAGAAGCTTCCATTGTTCATCATCCCAACCAACTACCAGTCATTCATTCTTGTTCTATATTCACCCACTCTTTAGTCTATCATTCCACGTCGCTCATTTCTGAAACTCCGCCTCCAAAACCATAAAAATGCGCCCCGTTCTCATCTCCATCTTCCTCGCGGCCACCGCCGTTCTGGCCCAGAACTGCGGTCCCAAGTACAAGAACAAGGTCTGCGCCGCTGGGAGCTGCTGCAGCCAGTATGGATGGGTGAGTAGCCGTCGTCAATACTCTCGAAGAAGCAGCTTTCAGTTTCTACGAGTTCTTTTCGTCAACCTTGTCGCCCGCTGACATGCCCTTCCGAATGCTCTAGTGCGACACCACCGCCGCCCATTGCGACCCGGCCACGTGCAAGCCCGAATTCTCGGGTCAGGGATCTAGCTGCAAGGTGAGAAGGGACTGATACTATAACTCTTTGCTATGACTTTTCAGAACTGCACACTAATCGCGGGGGAAAAAATAACCAAAGGCGAAAACCAATGGCGCCACGACTCTGGTGACCTCTTCCAGGACTCCAGTCACTGCGACTTCGTCAACCACTTCAGCCTCTGGGTCTCAGGCGACGTTCATGATGCAGGTCCCACACATCGACGTCTGCGGCAAAGACTCGGACGGCATCACCTGCCCCGGCGCCGGAACCAATGGGTACTTTTACCGCTGCTGCAGCTCGGCGGGACACTGCGGTGAGTTGTAAAAGCTCGCAGATTGTACTTCTCCTTGGGGAAATCGGGACTGGGCAAATATACTGACAGACTCATCATTTCTTGTCTAAACAGGCCCCAAGAACGACGTAAGCAGCTCTTTTCTACCCTTGTTCTCCTTCCATCTCGCTGTTTTTTTTTTTTTTTTTTTTTTTCAGCAGAAGAGAAGATATATACCAAGCTGTAAGGGCGAGTTTATGAGCAGATCAGCTGACACCACCGGCCCCCAAAATGCAGATCCAGGACGAGGCTATGTACTGCGGCACGGGCTGCCAGCCCGGCTTCGGAAACTGTCTGCTCGGCATGGCCAAGCCGCCCCTGCCAGTCAGCGCTCCCGGAATTGCGCAGGGCGGCGAGACCTGCGGTCCTATCGTGAACAAGAAGTGTGCGACTGGGCTTTGCTGCAGCGGCAGCAACTTCTGCGGTATGCTTTTTTTCTTCTTCTTTCTCCCAGGGCCCCACATTCTATATCTTGTTGATGTTTGCGCTCTGTAAAGCTTGAGCGCGAATGCAAACAAAAATAGAAAGAAAAGCTGACACTTTGCAATTTTTGTAACTTACTATAGGCACTGGCGAGGACTTTTGTGGTGCCGACAACTGGTGCCAGAAGAACTGGGGACACTGCAACTAAGCCTGCGGTGGCTAAAATCTTTGGATGTGGAGAAAAAAGTAAACGGAGGAATTTTCTAGAGTATTAACCAATATAAATACCCAGTGACGATGCGCTAATAATCGCAGTTCGTGGGGTCAGGTTAAACGGGTGGTTATTCTGGCTTAATGCGTAAAATAATTGAAGTTGGGAAAGGGTGGCGCTGTTTCCTAGAATATCTCTACTGCGGCATGATCATCATACCGTTTTAACATATGGCACTTACTTGACTTTTCTTTCTTTTTTTTCTTTTCTTTTCTTTTTCGGTTTTGACTTTGATCCGACAGAAGGGGTCATATTCATGGTGGTGGGAAAAGTATAAGTGGGCTCACGTGATTAGACTTTGCAAGACACTTTTCTGAGCATAACCCCCGCAATTTGGCGCTTCCGAGAAAGCGGCATATCCCATCTTGTCATGTCTGCGAATCGAGTCCCTCTCTTTAAAATTCCAAATCAAACAAGGCCGGGGGGTGGGTGAAGCTCCAAGCGAGCTTTTCGTCTTCCTAGACTAGGGTAACCCCGGGTGGTTTACCATTATCGTCAGGCGCCTACAACCCTCGAACGTCACGGCACAACAAAGTGAGCATGGCGCCCAAATCATCCATCGAAGAGTTCCAGGATCTGCTCGCTGGAATCGTAAGCAAAAGCAAGGATGGCAAGGGTGGTCGGGGACGAATGTTAGCGATCCTCGGCGCAGGTCTCGCAGCACCCTCAGGCCTACCTACGATGCGAGGCCCCGGTGGGTTGTGGCAGCGAAAGACAGCGGCAGTTTCGGAGCCAACAAACAGAACGGACTTGGAGATGGTATGGCTCTACTACGCCTGGCGACACCACCTCACTGCGGGGGCTTCACCCAACGCCGCACACAAGGCCCTTGCAAGCCTGGCGAGACACCGCCATCCCCAAACCTCGTCATCTACAACAGCCGCCCCGCCCACAAAAGATGGGGAATCGGCGGCCTCATCTCTGCCCGGCTTCGAGCTCATGTGCCTGAACCTAAGCCTGGATGATCTGCTCGTACGCGCGGGCTACCCACCCGAGTCCTTACGTGCCGCCTTTGGCTCCAACATGGCGCTTGTCTGCACCGACACATCCACGTGCTCGGCGGTCCGGCGGACCAGCACCACGGACCGACCCTGCCCATCGCTCGTCTCAGAAAGCGACGAGCCGCCGCGCTGGCTCACGGACCCGACGCTCGCCGTACCGGATCTGGAGCCCTCTAGGTTTCCACACTGTGCCGCGTGCGGAAAGCACCTAGTGCGGCCGACCGTCCAGCCCAACCGCCAGGCTCTCGCCGACGTGGATGACTTCGTGGCCAGGAAGCCCGCCGTCGACGTGGCGCTGGTGGTCGGGACGGCGGCAGTCCTGCCCCCCGCCCCGAGGTACCTGCACGAGACTATGAGGCACGGAGCGGTGGTCGTGGTGGTCAACCCGGACCCGGCCGTCGCCGAGGGCTTGCGGGATGAGGATTTCTTCTTTCAAGGGGATGCGGCTGAGATTCTTCCACGTCTGTTCGGCAAGGTTATTTCTTAATTCTAGACCTAGCTGAGGTTGCTCAGAGCAAAACAAAAGAGGTTTGAGCTAGTATAGCTTGGGGAGTGTGTTTACTGTCCCCCTAAAAAAAAAAAGCCATCGACGTGGACCGTTTTGTTGTGCGTGCACGGCACCATAACTGTCGAGCTTTCTTCCGTTTTCGTATTCCTGAAATTTGCCGGATCCGCTTGCTCGTCCAGACGTTTCCAAAGAGCTGGTCTAGACTTGCGGAATGGCATCCGGTAGTGAAAAATAAACTGCAAGCAAGCATTGCCTAATCGTCGTAGTCTGAGGGTTGAGACTGTCGCTTGCCGTCAAAATCGAATGGAACCGAACCATACTTTGAGACTGTTGAGAAATTCGCGCTTACCTACCCTGTCTTTCCAGTGCCGCCATGTGGGGTTTTACCTGTCAGCGACTGTTTCTCTCTGGCATCCATCCCCAAAGCCTAGAATTAAGCTTCCATCAGAATGATCCTTAATTGTACCCGAACTGCACGCACGAGTCTCGTATTGTTTTGCCACACCTTGTTTCTCCCTGTTCGGCTTGTTCCGACAGCAAAACCCTAGGAAGGCGGTAAACATATTTCTACTGAAGTTTCTAAAATGAACCAGTTTTGCCACATATATCAATTCTTTTTAAATTTGCGACGTTGTACAAATTACCGACAAATGTGCGCTACCCGCCGGCGTCAAAAGACGGAAAAGCTCAAGCCAGCAGGTTGTGGTTTAGGGGCCATAATTTGCTTAACGCAAGACGGACGGAAAAACGGAACCCTTTTTTTTGTACTAAAGAAAGAGAAGCCATTCCCACCGTTCCTGCTTTCGCAAAATCGAGGTTCGTCGGAATGCAATTAACCCGATTGTAATATGATAATGAGACGGCTTGAAATGCTGGCCTTCTTGCGGGAAGAAAGAAAAGCGCAAGCAAAAAAAGTCTAGACCTGAGGCCTCGGCACACACCCCCCTTGCCATCGTCACTCTTGGTTTCTCCTTCCCTTCTCCCGTCCCCCACTCTCCCTTTCGGCGTCTTGACGTATGTGGCTAGGGGTCTGCCGGCTTGAGAAGCGCAGTTGTCTTTTTTTTCTTTACTTGTTCTGGCTTAGGCTTTTTTTTTCTCTCTTCGACCCTGCGTCTGCCGTCAGACAGAATACGAGAGTAAGACAGTGGTTGGACGCGTATCCATAAAGGGTCGGGCTATTCGAAATGCAGGGCAATACACAAACGCGGTTAAGGCTTAGCATGCAACAAACCAATGTGACTTTGTTCCATCTGTTTCAAAAAAAAAAAGGCTGTGTTTGTTTGAAGGTTTGAATGGTGATGTTTTTGTCCTTGCGGACTATACCATAGTACAACATATTTTTGTCATAACCGTGTTGCAATGCAGATAATAGTTTCCGCACAAAGGCCCCCTCCCCATCTGCAAGTGAATGACTTGTGTCGTGCCTCTATTTGGAAATCAGAGCTGCACCAAATGCCGTAATACCCAAGGCTAAGACGACTTGGCCGTATTCTACGTAGTGAGTGGGATTGAAGCTGATTGAAAGAGTCCACCCCGGATCCATTATGCCAGGGGGAAAGGAACTGCTAAAAAAAAAAAAAAAAAAAAAGCGATGAGCAAGGAAGATGGGAAAGTGCCAGTGACGACAATTCGGTGCCTTGATGGGTATGCACAATGAGGTCAGAGTGCATCTTTTCTTGGCTCTTTCTTGGCATAGAAAAGAGCCAACGAAAAACGACAAATAGTCGCATTTCCCCCCTTCTAGCCGGTGGGGTTCGTTGCTTCAAAACTGACGATTGGTCCAAAATCTGTAAGCAAGATTTTTGAAGCTCACCACGGGGCGCCAGCAAAGGGAGGGAAGCTAGCCAGCATTACATCGCAGAATGCAATATCACGGGTAATGATGCATGGAGAGAAATGGAAACCTGCCGACGAACCTGGAAGACAAAGAAGCATGCCCGTGTTGGGAGCACATCGGTCCGGTCCTTTCTTTTTTGTCGAGCTTGAACACAGGCTGACTGATTCTTTGGGTCAACATCCATCTTTGTCATGTGGCTTGACTCTTTTGTTCAGCTTCTTATGTTCTAGCTTTAAGGGTCCACGAGGCCCAGAGAAAAAACTAAAAAAGAAAAAAAAGAAGAACAAAAGCCTCCATCTCAAACTTGGTTTGCACGTGGATTGTGGGTGCCGACCCGCCCTATGGATGGAGTACCAATTGCACAACGTTACCTTTAGGAGAGATTGTAAAACAGTTGGATAAAATGATGACAGGTTTTCGTCATATGAGAAGAGACTATCACTTTAAAGGAGATGCCCCAAAAGCAGGCGGATTGAAGTATCACACAATAATGAACGAATAAGAAGCTGTAGCTCTGCACCCTGCCAGATACCCCACCAGCTGGGCAGCACTATGACATCGTTTTGCAGCAAACAAAGAGGATCCTTTTTGTCAGAGCCGAGAGTATGGTATGTATGTAAATAAAGAGGATGGAACATGGGGAGGGGCTTGGGGGTAACAGGGAAAAGAAAGAGAGAGAGAAAAACCCACTCGTATAGAATAGCCGAAATTTGGCAGACAAAGTTTCCGCAAGCGATTCCGCACCCAAAAAGCCAAGGGTTTTTTTTTCTACCGTAATGGACCCCTCACGGGGCTAGACCCGACCGCCTGTTGCCGAGAAGAGGCTGGCCTCGCTGCATTATGCAGGGCACACAGCCGCTAAACGTAAGCGGTTGGCTCCCAAGGGGTTGTTTTTGTTGGCGTGTCTCTCTGTCCCTGGCGATTTTGTGTTGGATCTCGTTTGCAAACCTATTTGTGGTGTCTCAAAATCCTCACCGCAATCTGACACCGCAGCATGAGCCCTGACCTCATCGTGCTTGACGGGCACAAAGTAAAGTCATATATGCCGCTCGAGTGACACTGCTCCTCGTTTGCATATTACCTAATGTAGGTAGGTAGGTACCTGACTGTAGGTACAACTAGGTTTTGTGTACCTCACAGTGTCACCGTTTGCCAGGGTTACAGATGCGACGAAAATAAAATAAAAACAGAAGAAAAAGACATAAGCCCGAAGAATGCGAGCCAGGTCAGCAAAGAAATCAAAAGCGACTGGGGGGCTGACATGCAGCCCGCGTCCAGACCGGTTCTGCTGCAAGGGATTTGACGACTGTTCCTTCAAGGTCTAAAGTACCGAGTTTGGAAATTCATCCCCAGGAGGCGAATCTGGCAGAACATTCGGGTCGTCTTGTCCGTTCCAGACCGGCCGATGATCGACAAATTGCATACTGGCCTGTGTGTGCCTAGAACAGGTCTGTAAAAAATGAAAAAAAAAGTACAGCCCCTAAATGGAATGGCATACTCCGTCGCAAAGGGTTTTTCGTGGTGGCGCGACCAATTTGCGATATAGGACATTACAACGTTGCTTTCATTGTTGTTGTTTACTTTCCGGCGCGTACCCGAGTGTTCTAGACAAAGAAAACTTTAGGGATCCCAGACCTCGGCAAAGAACAAGGCATGAAGTGAGCATGACGACGGGCAACCCGCCCACCTCACTAACCTCCAAGCCACAAAACCCCTATGGCGTCGTGAGGGGTCCTGCTGGATTGTGTCATTCTTTTGTCTCTCCTAGGTTTTGGTGGAGAGCCCTGACCAGCAGCGTGTTCCTGGCGTTTAACGCTAGACGTGCTCGCGACATCCTTCCTCTTTCGTTGGGAAAAGGCTTGATCTCTCTCTCATTCTCACCTTCGGATGAACGTGCGTGATTCGAATTCAGCCAATGCTCCCCATCAGTGTACGTATACTCCATACGTAGAAGAACAAACGAGAGGGGAAAAAAAGAGGAGATAAGTCTCATTAATATCATGCAACTTACTTCTCCCCCCTCTCGACTTCGCAAGCACAGATATGCCCTCGGAGGTTTTGTAATATCAGATTAAACTAGCCTAGAACTAGTAGCAAAACACGACCACTGGACGTGGGTTTGAAATTTAGGGGTTCAAAGAGATCCAATGAAGGGGTGGGTTTCCAAAGGGGATGAACGAGTCTCATCATAAATTGCGCCAAAAGACACGGCAAAATATAAGCTGGCTTAATTACTGTACAATCCCAACACCCAAGTTTATCAGATGGCGGGAGTGGCAAGTAACAAACATCGCCGGTTATACTCCCTTTTTTTGGTAGCCTGATGTGCAGATCCTAATAATATGCTCCGATTCGCAAGGAGCTGGGCAAATCCCCAGGTAATCCCAAGTTTCAGATAGCAGCCGAGCAATTGGAAAAAGGGGCCGGCTGATCAACGCCGGGCTCCTCTATTTTGCTCTCCTCCGTGGCGATGACAGTTACCAACAACCACGTGGGTTGGGCGCTGATCAGTTGCCATCATCTCGTTGGTGGTATGAATTGCCGATAGCGTTGCAACGAATTCCCCGAGTTGACTAATGGCTATCACTAGAAGATGCCAGGCGGGCTTTGCTTCCCGGAGATCCCGTGCGAGCCTTGTGCAAAGGTTTTTATGGGCTCGGGCTTCGGACTCGAGGCCCAAGTAAAGTCGGTATTTGTTCCCAGAGTTATCTCCGCGTTGGCAAAACTTAATGTGGTGATATGCAACGGCAGTAACGGCAGTTAGATGCAGGGACCTTTTACTAGTGAGACTGCTAGCAGAACAAAATCTCGCTCCCATGCACCAAAGGCAAAGCAAAGGCAAAGTAATGTGTACCAGTAAATATAGTCGTAAAAATGTTATCAATTCAATTTTTTCCAAGCATCTGAATAAAAGGTATCTTCGTAAATGACCAAACGCCACAAAAGGTATCATAAGAAATCATCGCTATTTTCCCCTGTAATGCAACCAGTGTACAATGCCTTGAAATTCATCAAAGACCAGTCCAAGTCCAGCTAGTGGAATGATGAGCGCAAAAAAAACACAAAAAAAAACGCCTCGCTTGCGATGTAAATAAAAGAAGGTGAAGTGAAGAAAAAAAAAAGGGGGTAACAGCCAGCCCTAGACAAACCAGGTATTGAAATGAAAACAACGAAATCGATTCGTGAAAAATCTGGCTCATGTCCTCCGGAGATACAAAAGTACCCTTGGGCATGTCTCAGCATATGAGCGCTTAGGCAAAGATCGACGTCATTGCCTTGGCAGAGCCGACCCAAGGGCGGGGCGAAGCTCCAACGCGCAGAATATGGTATGCAAGCGATACCAAAATAGGAAAAACACGACTTTGGAAAACCAATGAGCACTGGCCATGACGTGCAGTGCCGTAGCAGCCAAAAAGTCCAATTCACTCGACGTTGGGTGACGGGTTGAATAAAAGCTGCATGTGCATTTGGATTACTGTGGTTGTGACAAAGTCACATGTTTCCACTAGAACCAAATAACAGATGACAGTGGCTTTGGGCGGCCTCTGCTGCCCAGTGGACAACATTGTTGTTTGTCTCGAGTCATGAATGTCGCTGTTTCCACCTATCAATCCCCTCTCGGGCCCTTCCGAGAATAGAAAAGGTTTGACGATTGGCCTATCGGTAGTCGGATTGCCAAGATGCCATTCTGGCACGACTGGGCCGAATTGGAGAGTAGCGAATGGGCGAGAGACTTGTCGCCAGCTCGGGCCCGTTGATCGGCATCATGAGGATATAACCTTGGTCGTGTTTCAAGTGTTTACCGCCGTCCGTAGCAGTCGGGGCAATTATGCCGCTGATTGACTGCGTCGAGGACAGGGCAAGTCACCAGTGTCGATGATCTTGTAATCCCCCACACCTGGGGCGGTGTCGAGATGTGCCCATCGTGTCGGTGAATTGCACTTGGTCCCATCCTACTCCCAAAGAAATGCCCTTCTCTGAGCTAAGTGGTTGCAAATCAATCAAGCTATCTGAGCTTGCGGATATGGGACGGGGTGAGGTATGTAGGAACGGGAGTAATGATGGCGAGCGAGCCGTGTCCGTGTATGTATGTGTGATTTTTGGTCCAAAGAAAAGAGACGTTGTAGTGGTAGGCAATCATGCATATCCGACGATCTTTGCACACCTCGAGCAGTAGT
TGCTTCCATCTACGACAGGAGCGACAGCATCGGCAGCTTGTAAACTGTCACGTTGGCTTGGTACTGGCGGCAACTTTGTCCGGTCCGCGTCACTGCCGGC
ACGCTCATGTGATTTGGGCTCTTCAACACTACCCAGCCTCTGCCTCGCTGCAGACACGCCGCTTCCCATGCCCATGCCCTCTAGCGACATCCACTGCGCC
TGTCTTTCGCCTCTCTCGGCACGCAGCTTCTCGGCCTCGTCTGGCTCGTAATCGGGCCCAGGGGCTCCCCATGGATCGGCATAGTGAGTTCCTTTCCGTC
GTGGAACTGGCTTCCTCCTTGGCCGGCTCCCATCGGTGCTGATTTTGTGTCTTTGACGTCTACCTGGCGTCGCTGCTGCAGGAGAAGTCGACGGCGATGA
CACTGGTGACATGTTTCGACCCGCCGGCATTCCTACGGTGACAGGTGAAGCATGATCTCGAAACCCATCTGCCGCCAAGGCCGTTGCGACCGCCATTGTT
TCTGGGGATGGCGCATCGGCCGTGGCAACGTGTGGGCTTGGAGTCCAGGGTGGTGCATCACCGCGGTCCATTTCTGTGTTCAACGTTGGCAGCACAGGAT
GACTTGTACTCGGAGAGTTAGCTGTGTTTGGAGGCAATGTAGGCGATATTGCTCTCTGTGCTGACTCAACGTCGGGGCTGAGTGGCGTCATTGCCGTTTG
TGTCGTGCTCTGGAAGGCAGCACTGCTTCGGACGTTCATCTCGACATCACGAGTATCGGCCTCATGCGTTGGTCGTGGGGCGCGCCGTCCTGGCAGAACA
ACGACGGGCTCTCCAGTAATCAGGTACATTATACGAGGTGTTGAACCCATAAAGGCATTATCGATACAACCGCGTATGGAAAGTATAAAGTGGAAAAGAC
TGTTTCACATCACTTGGGTTAGTTGGACTTGATGCGATTGACCCAGGGGGGGTTGATTACTGACCTTGACAATGCAGTTAGGGGTATCGCCGCCTGATAA
TACGCCAGGTCTGCGTAATTGTGAAGAAATAAAATAAATATTTGGTACCCAACAGCAGCCAAGGCAAGGAGAAATATGAACGCGTCGAGGAATATATGGG
CCTTGGCGGAGATTCCGCGGCCTTTGCGGAAACACATGGTGATAAACTCGGCACTGTTCCAACTCATGATCACAGCGGCCTTGTGGGATACGTCACGTTA
GCCTATGTCCCTCCCTCACAAGCATTGCTGTACAACTGGCCGGGTTGACATCCTGTCGGGAACACTTACAAGCACGTATTGGAGGACGTCGTTAATAAAT
GACCATATATCCGGATAGGAAATAGACATCCAGGGTTGCCGGTTAATTTGTACCGGCACCATGGTCACAGCAAAACCCGTGGTCGACACCCTCAAAACAA
CCTTTGCTATGTACCATCCGTTGATAACCGGCTTATCAAGAGCCTCCAATTCTTCGCGAGGCAGCCGTGAGCGGGGGTCCATCCCCGGATCCGTCTGTTT
GCTTGCATCAGCACTGGACGATTGCGTCGACAGCTGCGGCCTTGTTGGTGTTGCTGCTGCCGGAGCCAAGCTGCTAAATCCCCGTGCCATGTCGCTAACC
GCTGTGTTCTCCGAGGACGGCAACACAGGAGCCGTGGCCCGCGCCCCCATGATTGCTCTCATTGTCTTTCTCATGGTGGCATCTAGGCCATTGGCGGGTC
AGTTTGGGCCTATGACTGAAGATCGACCGATTCTTCAAGCGGTTCATGCCATGCCCTTGATGCAACCGTGATATTCACAATGCGCAGTTGTGGCACATAG
GCCATCCAAACAACCGTCGACGCGACCGACAGTTGAATGGCGGAAGGGCGCCCCGTTGGACGCGACAGACAACTGGCCGCCACCGCCGATTGGCTCCGTC
AATCCAATGAGGAGAAGGGACTCCCAAGCTGAAACCTCCAATGGCCCGTCTCCAGAAAAGGCTGCTGAGAGGTCAACAACCAACTGGCGGCGTAGTCTGT
GCTGCGTCAGCAACTGGTACTTGTGGTGACAGTTTGAGTGCGACTGCATGGAGCAGAGACAAATGTACGAAATTACAAAGTACAAACAGCAAATTGGTCA
GGCTGCGGAGGGGGGACACGGGGGGAGCGCTTGAGCGAACCGAACTCGCGGTTCCAGGCAGCAGTTTAAAGTGCTTGGCGAACAGGGGTTTGAATGGAGA
TTTTGACTGACAAGTCGTCCATCAGGATCTGGACATAATCACGCTTGTGTCTCCTCCTTTGCCCTCTTCGACAATGCGCACGGCATGCCATTCTACTTCG
TACAATCCACTACCTGACTTTAAGCTTACTTTGGAAACATACTGAGTCCCCTAGTTGGTGCAAAACACGGCACCGAAAACTTTCAAGATGGAGGCCCACC
CATGCATTTTCTGAAGTAACACCAACAGTCACTAACTTCTTCTGTCGTATTTGGCTATGCCCACATTCAGCTAGTCTGTGTTTTGGTTTGGATAACATGG
ACATATGGAATTTATGATCAATAAAGGAGAGAATGGCCACCAAGCCAAAAACTGACGTATCCAACATCTCCACCGCAGAAGAGAAGGCTATAGAAACAGA
AAAAAAAAGGTCGATCAAGGAGCGTCGAGAATCTAAAAACTAAAATTCCACGTTGGCTGCTTTCAAAAAGAGGGGAAACAGTCAACTTATTACCAATAAC
CAACCATACCACAGTCTATTCCTTTTCACGAAAGCTTCCTTCCCCTGAAATCCCACGCCAAACAGCCTCCCCTTTCAACAACATCGACTAGGCCTCACAA
CCTAGCAAAGATCTTAAGCAAGGACAACGTTACGCTTCGCCCAGCGCTTGTACCCGTACCCGGGGTAGCCACCGTATCCGGGCGGGCTCCAGGGGGTGGT
CGTGGCGGCCTGCGAGGTCGAGGTCGAGGAACCCGGTCCGTAGCCTGTGGTGGTGGTCACAGCGTCGGAGCTGGTGCTGCTGGTGCTACCAATGGGCTCG
GCAGCCGACGTCTGGGTCACAAAGGTGCTCGGCGATGTGGTCGGAATGGGCGGGTAGCCGCCGCCGCTGCTCGTTGCCGGGGGCTGCGACTCCGTGATGG
ACGACGGGCCGTACGACGAGGAAGCGCTGCCGGTGGCTGTGGTGTAGTAGGTGGATGACTCGCTGCCAGTCTCGGTGCTGCTGGCTGCGGAGGAAGTGGC
CGAGGAGACTGGCAGAGCCCCAGAGGTCTCCGATCCGCCTGTGGTAGTGGGAGGACCATAGCCACCGCCAGTCGTGGATGGAGAGCCTGATGCGGTTGTC
GAAGACTCGCTAGAGGCGCTGGTGCTGCTGCTGTAGCCTGCGGAGGAAGTGGCCGAGGAGACTGGCAGGGCACCCGAGGTCTCTGATCCGCCTGTGGTAG
TAGAAGAGCCGTAGCCGCCACCAGTCGTGGATGAAGAGCCTGATGCGGTCGTTGGGGACTCGCTAGTGGAGGAGGTGGTGGTGCTGCCTCCGTAGCTGGT
GGCAGGCGAAGTGGCGGCCGTCGTTGAAGTCTCAACTCCGGTAGAGCCGGTTCCGTACGTGGAAGACGCGGCGCTGCTGCTGATGCTCGTGGCACCGGTC
TCAGTAACCGAGGTCCCGGAGCTGGCGGGACCGGTTGTGGTGCCGGTGGTAGTGGTGCGTTTAGTGCACTTTGTCTTGGTGGACGTCAGGTCCGTCGACG
ACTCGGTGCTCACAGTGCCGTAAGTCGCCGAGGTAGCAGGCCCAGTCGAGGTCCCGGTGCTGCTGATAGCATCTGTAGCGGACGTCTCAGGTCCAGTCGG
CGTCAACGTTGAGCTGATGCCGTATGTCGCGGAAGTGTCAGGGCCAGTCGAGGTTCCGACGCTGCTTGTTTCAGAGGTGGCAGAAGTGTCAGGACCGGTG
GACGTTCCCGTGGTGCTGGTACCGTACGTAGCAGACGTCTCGGGGCCGGTAGGGGTGCCAGTATAGCTTATTCCGTAGGTTGCCGAGGTCTCAGTGCCTG
TAGTCGTGCCCGTGCTGACAGTCTCGTACGAGCTGGAAGTGCCGGGCGTGGTCTCGGGGCTGGTCGAGGTGCCTCCGCTCTCAGTCGCCGACGTGGTCAC
ATCGGTCGTGCTGGCTGTCGTGCTGGCTGTCGTGCTGCCGGTCTCCTGTGTCGACGATGCTGTCTTGGTGACGGTGCCAGTTGCCGTGATGGTGATGCGG
GTGGTGATGTCAGTTGAGCTGGTGCCGTACGTCGATGTCTCTGAAGTCGCGGGCGATGTTCCAGAGGTCTCAGTGGTGCCGGGGACTGTCTCGCTTGTCT
CCGTAGAAGAGCTGGCTGACGTGACGCTTGACGAGCTGTAAGACGGCGATATAGGCAGGTTTGAGCTCACAGTGATGTCAGAGCTAGTGGATGACGTGCT
CGGGGCTTCACTGCTGGAAGACCCAGACTGGCAGCCATATCCGTAGCAGCTGGTCACGGGCGGTGCGGTTGTGCTGCTTCCCGGAGGACTGGTCGACACT
GACGTCTCGGTGGGAGGGGAACCAGAATCAGACGGGCTGTAGGTGCTTGTGCTCTCTGGCGGAGGCAGAGTCGTCGAGGATTCGTAGCTGCTCGAAGAAG
CGTCGGTTGTCGGGGGTGACGTCTCGCTGGTCTCAGGAGGCGCGGTCGAGGACCTAGACGACGACACGTTGCTCGTGGCAGATGTCTCGGTCGTGCCTGG
AGCCGTGCTTGAGACCGAGCTCTCAGGACCAGTTGACGACGGGGGAGGCCCATACGAACCGCTGGAGGTGGGCGGGGCGCTGCTCGAGGAATCAGGCGGA
GGAGCCGAAGTAGTGCCCGGGGGAGGTCCGTAGGTGCTCGAGCCTGACGGCTGATCGGTGCTCGTAGTTGCCGGGGGTGGGATGCTGCTGGATCCAGGAG
GGCTACTAGTCTCCGGTGGCTGGGACTCGGAAGAGGTCGGAGGCCCGTAGGTGGCAGACGTGCCAGGCGGGAGTGTCTCGGTAGTCTCTGGCGGCGCGGT
GCTGGTGCTGTAGCTCGATGAGGCGGACTGGCTGATTGCATCAGTACGAGACGTCTCGATGGTGCTACCAGGAGTGGTGGTGCCCGACGGTGGGAGCGTC
GGGGTCTCCGTATCAGACGACAGAGTCGAGGTCGGAGGGCCTGGAAAGCACGTCGAGGCGCACGCCGTCACGGTCACGGTGGTGGTCACAGTGCCGTAGT
TGTAACCTTGCGGCACAGCCTGTACCAGGCCAGAGCTGTATTGTGAGTAAAGGAAGATATAGTGTCAGCACAGAGGAAGAGGACCCTAGTTGTCTTCGGC
TCGCCCGGGCGCTTGTTGGTGCTTGTTTCTGGCGTACTTGTGGTTGGCAGTACATGTATTTGGGAAGGACAAGCTTATCCTAACCCCGACACATGGTTCA
CCACAAGCGCAAAGGCAAAAATCAAGACAAGAGGAGGAAACGTGAAGCAGGAGTTGGAGAAAAGGTTGGAACATACCCCAAGCCCATAAGGGCCATCCGA
GTGAGACCGCGCATGCTGGCTACAAGACCAGGTGTGGGCAATGAATAAACGAGTGTTATAAGAGCGAGCGTAGGTGGGGATGACAGTAAGACTTCCTACA
GACAAACACCAGTGACGGACCCCTTGGTGAGAGTGACAGTGGCCGGAGGGTTGGAGAGAAGCTCGAGAGTATCAAGAATCCTCTGGTCCTGTCTCTCAAA
AGGAGCTGTGTTCTCCTGCCATGGGGAAGAGGAAGCCTTGGGGGGGGGTTTTATAGCATCCCATGTCGCCTACTCGGATATGCCGACTTGGCTTTGTCAG
ACGGATATGGGCTCCTTTTGCCCCGTCCGGTACATTGACATGTCCTTCTCGAATAGATAGATACACATGCACCATACCTTGCTCACCTTGCGTGAACTGG
TGGCTCCCGAACCAGCCACGCGAGGCCATGCATCTTTCGATCATGGCCACACCCCCCATGTACACCTGCCCTGGCATCTGCAACAAAGGCTCGCGTGAGA
CGGCGTATTCTGGGCTTGCATGGAGAAATTATCAGTCAGTCAGTCAGCCTCCAAGATCGGGCTTTCCTTCTAGGTACGTCAGTCAGTCGTTGACGTGCCT
TGATGAGCTTGGCCCCATAGCAAGCCTATTTGTTGAAGAGCGCATTTGTGTCTTGGCCCGGACATTGGGCCTGGACTCGTCGGGATCTACTTCAGCTTTC
GATAGGAACCGGAGACGGGTAGGCACGCCTCGGCCTGCAGGGATTAATGCCGTCCAGAGGTTATCCCGCCAGACAGCTATCATCAATCTTGATCTTGATC
TCCGAGGCTTTCCAGCCTGTCCCGTGGGCTGAGGCCCTTCCCGTGGTGGCGTCTGCACCAACGAGGTTAGGTATTGGGCAGGGTCACCTCAATCTTCATA
ATCTTGCCAGTACTTTCATTATCTGTGGTCATGACTTTGCTTGTTTAATATGAGCAGAGCGAGGAAAAAGAGAAAAAATAAAAATTCGTAACTACTCAAC
TAAAGGTAAACTCACCTCCAGGAACACTTCACTATGGGATTGAATGAAAGGAACTCACCTATTCGATCTGATCACAAAAGTCCACCGGCGTGACAAGCAC
AAGGCTCCCTCCCTCTCGCCCAAACTCGGCCTGCCCATCTGAACCCCATGTTGTATGCGGGTGGCACCCATCTATGGTCCGCAAACGGGTGAACCGGAAA
GCAAGCTTTATTCAATGTCGTGCCCGTGCAACGTCTGGGCCAGCATGGGGGTCAACACAGAGGGTATGTTTGTCTTGCCATGAGAGTCAGGAAGCCAACC
ATTATTCGGGACTGGGACGGCCGAGCTCACACTTTATCCGCCCGTTGTTTGCTTGTTGCGCAAGACATGTGTCGTCAATTTTGTCTGACCAGACCACCAA
GATGGTTTATTGTGAGACCAAAAATCATGACCTTACTGACCTTGGTGTGCTATAGCTTGCCCAGCCGTGACGCTGCAGAAAGACACCAACTGACCATTCT
ATGGACTCTCGATCTTTTGTTGGGCTGGCCTTGAAGGCCAGGAAAGAGTAAGTATACGAGCACCCTGCTGTCCGCTTCACCTGGTCCGGATGTTACCTCA
TGAGCCGGGTGGACCGCGGTCCTCGTACCACACGGATCTAGGTAGAAGTTCTTGTAGCACAAGCTGAGTGCCTTGATTTACAACACGTCGTTGCTATTGC
AGCCCTAGAGGCTATTGGTTATAACAGTTTCAGTAGAGTCGCTGTCTTAACGACTGTACACTGGTCTGCAAGACGGCAAATACTGCCGTAGTTGAAGCTA
TGATGAACGAAGCTCCGATGGACTGACTGGTACGAGGCTGAGGCTGCGTTGATGATCGACGTTCTTACCAGAAGCTGATGATCGATCTTGGTTCATCGAG
TGGAATCATCCTTAGGATGGGGCTATCAAAAGCATGTGAATGCTAGTCTGCTAAGCCAGGTGACACCGATCTTCTATTTTCTGGCTTCTCAGCTTTGACC
GTACCTGCAGTGGCTGGGCTGTGAGTATCCGTGAGGGGAAAGGGAAGGGCAAGAATTAGCCTGCAACAGTCCGAGCACAAAGCATTTGATAATTTCCCGG
CGTTGCAGACAAATTGACAATGCCCCCCAGGCATTCTGGGAGCGATCAATAGTTCCGAATGGACGCCGCTTGCGTTTCTGTCTGGCAGATGAAAATATCT
GGCGTATAATAATTGATTGGCGAGTGCATATGTTGCTCAGAATCTGCAACTCAAAGTCAGAAGTGCCTTTCTGACCATTTCGTGTATAGCTCAATGGTTT
GCTAGTGACGATGGCGATTGGAATGCATGATGACATTGGCTGATGCTGATGTAGCCATGGCATTTTGAACTTGTTCACCAGTCGTATCTGGGACAAAATA
ATTTCTGCTTTTCAGACCAGAAGCACGGAAAAACAGGTCATGTATTGAATGTAAAATCGACAGCAGTTGTTTGCGGAAATTCCTGTTGATAGTCCGTCCG
CTGACTTGGAGATGTCCTCACCCGAGACTCTTCGACGGGAAGCCAAGCTGAAAAACAGGTCGAGGTTTGGTAGTGGACTGAGGACAACAGAAGGTACCCA
GTGGGCAGTACCTTTTCACATCTGCAGCTGATTCCCTAGGTACCCTAGGATCTGGCCTGGATCTGGAGAATTGAGACATGTTTTCCGAGTTTGAGCAACC
CACCCACCCTTTCGCATGCACCTGCTGGTCGCACGCATTTGCTGACCAAGAAAAGGTTGGCCCATCTACCATGGCAAGGTCAACCAACACGAGCAGTCGT
GTCACAGTGGCGTCTCCAAGATGGAAAGAAGGACTGGAGGGTTGGCAATCGTATTCTCCGCCACTTGCAGCTAAGGTACCTTCCGTCCTGAATTTGCTAT
CGATTGCTGTTTTGCCCCTGAACTAGTAACGACGCCACAAATGAGTGGTTTCTGCAGCCTTTGTTTCGGACTTTTAGAATCCTTTGGCTTCATTCAATTT
TCACGAAAAAAAAGCCACAGCCATTTGGGGCACAAAATCGCCGCTTAGGATGGAAGAAAGCAGTGTACACTGCAGCTCCTCATATCAACTTTTGCCCACC
GTTAAGTCTGCTACTTCACGGTGCACATTTCGGCGAAGGTGGTCTGTCTCACAATCTGATATTTAATAACTTTCAGACATCTAATCTCATATCATATCAT
ATACCTTCTCTGGGCCACACAACTTGCTCAACCACAATCTGCAAGTGCCATTTCGCTTCAGAAAAAAAAAGAAGAAGAAAACAAAAGAAATCCACAAACT
CTAGAGATTGCAAAGACGCAGAGACTGACGATTAATGTTCAAATACAACGTAGGCATGTACAACCTCGTTCCGAAAACCTGCCTAAGGAGGTCCAGTTGC
TTGGCATTGAGCTACTGCTTCACACTGCCTCTAGAACTAGCAACCAAGTAATGCCAGGCATCGTGGAACTGTTGGGGACATCTGAGCTCGTAAACCCTCC
CTAATCCAATATTTCTCTTCTGAAGCTGACACATATGACAGTGGAGACGAACGTCTTAGCGAGCACATACTCATCGTCAATGAGACGCTCTATCAAACCT
ACAAACTGTCATGAGCTCACTTTATATTGGTCCTTTCGCGGGCGAACGCGCGATCAAAGTCTATGGACTAGGCTAGGTACATACATACATGCATATCGAG
ACATTCGAACTTGGCCCTCATCTACCTTCCTACGTTCATTCCCTTCAATCCACAAATGCGAGAGGTACATGCTGGAAATCGCATTGGGAAAATTGTGACT
CCGCCAGGATTGCTTCCTGGCGAATATCTTACCGGAGTAGAATATACCGTGAAATCTTGCTATTAGGTTGCCATCAACATGCTCTTCTCGACGCTCTTTT
CACTGTGTTCCCTGGATACTCAAAGGTTATTTGTACTTGGTACTTTCATTTCCTTGGCTTTCTCACTAACTTCAGCTCAGGATAAAGATGGCTGTTGGTT
CCGCGAGGATCCCAACTCGGCCGCTGACGATGTCGTCTTACGCCTCTTGGTGACAACTGGGTCCCTTCTAGCATGTGCCTCCAGGCATTGGTGGGTTTCC
TACCAGCACCAGCGCAAGCCCGTCGACTTTGCCGCCATCATCTGTGACTGTGATAGTTTCAGTAACCTCCGTGACGACAAGCACGGCGCTTACCACGAGC
ACCACTATTACCGCTACCACCTCGAGCACAATCACAACATCCACCTCCACCACAACCAACACCATGGTCGAAACCCAGACCCCCTACGTCCGCACAATCA
TCCGTCACCACGACGCCCACCGTGCAAACCACAGCGCCCCGGCCCTGGCCTGGTCCGACTCCCTCGCCGGCACCGCGCAGTCCATCGCCGAAAC
GTGCAT
CTTCCAGCACAACACAACGGCGGACAGCGGCGATTACGGGCAAAACATTGTAGCCGGCGTGCCGGAAAACCAGATGGGCATCGTGGTGACGGACACGTTC
TACAACCCCTAG
GTGTGCTAACTACACGTGGTACGGCAGCGAGCCTGATCTCGTCGACTTTAGCCGCTGGGGCCACTTTTCTCAACTGATCTGGACGTCG
ACGGCGGAGGTGGGCTGCGCGACCGTGGACTGCTCTTCGCGTCAGTGCGGGCTCCAAAACGTACAGGGCCAGCCGCCGTACTTTACCGTGTGCAACTACA
AGCCGCCAGGCGCACCGCTTGGCTCCCCGAGTATCGATGGCACTTTTATGTGCGGAAGCAGCATCAATTTCAGCTATAGCCTTGTTTTTGGGTCGCGGTT
GTAA
TTACAGTCCTCATTGTGGAATGGTCACAATGTGTAGGCTGTATTTTTATCAAGAATCATGGCCAGGAAACGGCGCTTGCCAAGAGAAAGGAATTGT
TCCCTGGATGAAAGCCACTGAAGATGCTAGTAGACTTGTAATCTTGGCACCTGGGTAGCTAGCACGGTAGCTGGAGCTTGATCTGTTGCTCTTGGTCGCC
ATTCCAGTCACAAAGCAGGCGACCAAGAAAAAAAAACACGAGGCTTGGCTTTTGAAGTCGTGAAAACAAGCCTTTGCGGCGGTTGATCTACCTATTACCA
AAACTTAACGCAATATTGTTTTTATTTCAGCCTATGACTGGCACTTGACGAATTTGATAAAGAAAGCAATCATTAACACCCTACTCAGCCCTGCGAAATT
GTATCCCACAGCCTCAAAAGGACCCCTGAACCGTGCTTACATTCAATTCAGTCTGTTAGGCAGCCCAGGGGCGACTTCAATATCACATCACTAAATCGTC
TGTTCCAACCCAATCACAAAGCGAGCAGGACTCAGATTGCGGCATCCGACTGCAAGCTAGAGCGACTCCTGCAATGACAGCGGTGATCCGGAAGTTGCCA
TCAGGCCACAAGTGCTAGCTGAAGTACCGAGCCCTATGACTAAAATAAGTAGTCGGGTTTTGGTTCAAGTAACATCTGAGCGCAAATAGAGAGTGTCAAA
CCTGTCTGTCTCGCGTTCACCTTAGACTCCCTTCCCAACAAAATACAGGGTCTACTAGCTGCTAAGCGCACAAACAGAGCTCCATCTTGATCACAGAAAG
TCGACGGGGTCTGGAATTCTCGTCCTCAACCATTCGCCCACCCAAGAACGCTATGTTCCCCAACCCGCCAAAATCTGGGTCTTTCAGCTGAGCGTTAGGG
CCGTTACAGAAGGCGATATTATCACGCCTTTTGCAAGATATACACTATTGTTTGTTGCTCGATTCTATGGGAGGATCCGGTTGGTGTCTTGGCAAGAAAC
AGAAAAACGAGTATAAGACAACGGTAGAAGACTTGGCGATCTCTTAGAAGCTTCCATTGTTCATCATCCCAACCAACTACCAGTCATTCATTCTTGTTCT
ATATTCACCCACTCTTTAGTCTATCATTCCACGTCGCTCATTTCTGAAACTCCGCCTCCAAAACCATAAAAATGCGCCCCGTTCTCATCTCCATCTTCCT
CGCGGCCACCGCCGTTCTGGCCCAGAACTGCGGTCCCAAGTACAAGAACAAGGTCTGCGCCGCTGGGAGCTGCTGCAGCCAGTATGGATGGGTGAGTAGC
CGTCGTCAATACTCTCGAAGAAGCAGCTTTCAGTTTCTACGAGTTCTTTTCGTCAACCTTGTCGCCCGCTGACATGCCCTTCCGAATGCTCTAGTGCGAC
ACCACCGCCGCCCATTGCGACCCGGCCACGTGCAAGCCCGAATTCTCGGGTCAGGGATCTAGCTGCAAGGTGAGAAGGGACTGATACTATAACTCTTTGC
TATGACTTTTCAGAACTGCACACTAATCGCGGGGGAAAAAATAACCAAAGGCGAAAACCAATGGCGCCACGACTCTGGTGACCTCTTCCAGGACTCCAGT
CACTGCGACTTCGTCAACCACTTCAGCCTCTGGGTCTCAGGCGACGTTCATGATGCAGGTCCCACACATCGACGTCTGCGGCAAAGACTCGGACGGCATC
ACCTGCCCCGGCGCCGGAACCAATGGGTACTTTTACCGCTGCTGCAGCTCGGCGGGACACTGCGGTGAGTTGTAAAAGCTCGCAGATTGTACTTCTCCTT
GGGGAAATCGGGACTGGGCAAATATACTGACAGACTCATCATTTCTTGTCTAAACAGGCCCCAAGAACGACGTAAGCAGCTCTTTTCTACCCTTGTTCTC
CTTCCATCTCGCTGTTTTTTTTTTTTTTTTTTTTTTTCAGCAGAAGAGAAGATATATACCAAGCTGTAAGGGCGAGTTTATGAGCAGATCAGCTGACACC
ACCGGCCCCCAAAATGCAGATCCAGGACGAGGCTATGTACTGCGGCACGGGCTGCCAGCCCGGCTTCGGAAACTGTCTGCTCGGCATGGCCAAGCCGCCC
CTGCCAGTCAGCGCTCCCGGAATTGCGCAGGGCGGCGAGACCTGCGGTCCTATCGTGAACAAGAAGTGTGCGACTGGGCTTTGCTGCAGCGGCAGCAACT
TCTGCGGTATGCTTTTTTTCTTCTTCTTTCTCCCAGGGCCCCACATTCTATATCTTGTTGATGTTTGCGCTCTGTAAAGCTTGAGCGCGAATGCAAACAA
AAATAGAAAGAAAAGCTGACACTTTGCAATTTTTGTAACTTACTATAGGCACTGGCGAGGACTTTTGTGGTGCCGACAACTGGTGCCAGAAGAACTGGGG
ACACTGCAACTAAGCCTGCGGTGGCTAAAATCTTTGGATGTGGAGAAAAAAGTAAACGGAGGAATTTTCTAGAGTATTAACCAATATAAATACCCAGTGA
CGATGCGCTAATAATCGCAGTTCGTGGGGTCAGGTTAAACGGGTGGTTATTCTGGCTTAATGCGTAAAATAATTGAAGTTGGGAAAGGGTGGCGCTGTTT
CCTAGAATATCTCTACTGCGGCATGATCATCATACCGTTTTAACATATGGCACTTACTTGACTTTTCTTTCTTTTTTTTCTTTTCTTTTCTTTTTCGGTT
TTGACTTTGATCCGACAGAAGGGGTCATATTCATGGTGGTGGGAAAAGTATAAGTGGGCTCACGTGATTAGACTTTGCAAGACACTTTTCTGAGCATAAC
CCCCGCAATTTGGCGCTTCCGAGAAAGCGGCATATCCCATCTTGTCATGTCTGCGAATCGAGTCCCTCTCTTTAAAATTCCAAATCAAACAAGGCCGGGG
GGTGGGTGAAGCTCCAAGCGAGCTTTTCGTCTTCCTAGACTAGGGTAACCCCGGGTGGTTTACCATTATCGTCAGGCGCCTACAACCCTCGAACGTCACG
GCACAACAAAGTGAGCATGGCGCCCAAATCATCCATCGAAGAGTTCCAGGATCTGCTCGCTGGAATCGTAAGCAAAAGCAAGGATGGCAAGGGTGGTCGG
GGACGAATGTTAGCGATCCTCGGCGCAGGTCTCGCAGCACCCTCAGGCCTACCTACGATGCGAGGCCCCGGTGGGTTGTGGCAGCGAAAGACAGCGGCAG
TTTCGGAGCCAACAAACAGAACGGACTTGGAGATGGTATGGCTCTACTACGCCTGGCGACACCACCTCACTGCGGGGGCTTCACCCAACGCCGCACACAA
GGCCCTTGCAAGCCTGGCGAGACACCGCCATCCCCAAACCTCGTCATCTACAACAGCCGCCCCGCCCACAAAAGATGGGGAATCGGCGGCCTCATCTCTG
CCCGGCTTCGAGCTCATGTGCCTGAACCTAAGCCTGGATGATCTGCTCGTACGCGCGGGCTACCCACCCGAGTCCTTACGTGCCGCCTTTGGCTCCAACA
TGGCGCTTGTCTGCACCGACACATCCACGTGCTCGGCGGTCCGGCGGACCAGCACCACGGACCGACCCTGCCCATCGCTCGTCTCAGAAAGCGACGAGCC
GCCGCGCTGGCTCACGGACCCGACGCTCGCCGTACCGGATCTGGAGCCCTCTAGGTTTCCACACTGTGCCGCGTGCGGAAAGCACCTAGTGCGGCCGACC
GTCCAGCCCAACCGCCAGGCTCTCGCCGACGTGGATGACTTCGTGGCCAGGAAGCCCGCCGTCGACGTGGCGCTGGTGGTCGGGACGGCGGCAGTCCTGC
CCCCCGCCCCGAGGTACCTGCACGAGACTATGAGGCACGGAGCGGTGGTCGTGGTGGTCAACCCGGACCCGGCCGTCGCCGAGGGCTTGCGGGATGAGGA
TTTCTTCTTTCAAGGGGATGCGGCTGAGATTCTTCCACGTCTGTTCGGCAAGGTTATTTCTTAATTCTAGACCTAGCTGAGGTTGCTCAGAGCAAAACAA
AAGAGGTTTGAGCTAGTATAGCTTGGGGAGTGTGTTTACTGTCCCCCTAAAAAAAAAAAGCCATCGACGTGGACCGTTTTGTTGTGCGTGCACGGCACCA
TAACTGTCGAGCTTTCTTCCGTTTTCGTATTCCTGAAATTTGCCGGATCCGCTTGCTCGTCCAGACGTTTCCAAAGAGCTGGTCTAGACTTGCGGAATGG
CATCCGGTAGTGAAAAATAAACTGCAAGCAAGCATTGCCTAATCGTCGTAGTCTGAGGGTTGAGACTGTCGCTTGCCGTCAAAATCGAATGGAACCGAAC
CATACTTTGAGACTGTTGAGAAATTCGCGCTTACCTACCCTGTCTTTCCAGTGCCGCCATGTGGGGTTTTACCTGTCAGCGACTGTTTCTCTCTGGCATC
CATCCCCAAAGCCTAGAATTAAGCTTCCATCAGAATGATCCTTAATTGTACCCGAACTGCACGCACGAGTCTCGTATTGTTTTGCCACACCTTGTTTCTC
CCTGTTCGGCTTGTTCCGACAGCAAAACCCTAGGAAGGCGGTAAACATATTTCTACTGAAGTTTCTAAAATGAACCAGTTTTGCCACATATATCAATTCT
TTTTAAATTTGCGACGTTGTACAAATTACCGACAAATGTGCGCTACCCGCCGGCGTCAAAAGACGGAAAAGCTCAAGCCAGCAGGTTGTGGTTTAGGGGC
CATAATTTGCTTAACGCAAGACGGACGGAAAAACGGAACCCTTTTTTTTGTACTAAAGAAAGAGAAGCCATTCCCACCGTTCCTGCTTTCGCAAAATCGA
GGTTCGTCGGAATGCAATTAACCCGATTGTAATATGATAATGAGACGGCTTGAAATGCTGGCCTTCTTGCGGGAAGAAAGAAAAGCGCAAGCAAAAAAAG
TCTAGACCTGAGGCCTCGGCACACACCCCCCTTGCCATCGTCACTCTTGGTTTCTCCTTCCCTTCTCCCGTCCCCCACTCTCCCTTTCGGCGTCTTGACG
TATGTGGCTAGGGGTCTGCCGGCTTGAGAAGCGCAGTTGTCTTTTTTTTCTTTACTTGTTCTGGCTTAGGCTTTTTTTTTCTCTCTTCGACCCTGCGTCT
GCCGTCAGACAGAATACGAGAGTAAGACAGTGGTTGGACGCGTATCCATAAAGGGTCGGGCTATTCGAAATGCAGGGCAATACACAAACGCGGTTAAGGC
TTAGCATGCAACAAACCAATGTGACTTTGTTCCATCTGTTTCAAAAAAAAAAAGGCTGTGTTTGTTTGAAGGTTTGAATGGTGATGTTTTTGTCCTTGCG
GACTATACCATAGTACAACATATTTTTGTCATAACCGTGTTGCAATGCAGATAATAGTTTCCGCACAAAGGCCCCCTCCCCATCTGCAAGTGAATGACTT
GTGTCGTGCCTCTATTTGGAAATCAGAGCTGCACCAAATGCCGTAATACCCAAGGCTAAGACGACTTGGCCGTATTCTACGTAGTGAGTGGGATTGAAGC
TGATTGAAAGAGTCCACCCCGGATCCATTATGCCAGGGGGAAAGGAACTGCTAAAAAAAAAAAAAAAAAAAAAGCGATGAGCAAGGAAGATGGGAAAGTG
CCAGTGACGACAATTCGGTGCCTTGATGGGTATGCACAATGAGGTCAGAGTGCATCTTTTCTTGGCTCTTTCTTGGCATAGAAAAGAGCCAACGAAAAAC
GACAAATAGTCGCATTTCCCCCCTTCTAGCCGGTGGGGTTCGTTGCTTCAAAACTGACGATTGGTCCAAAATCTGTAAGCAAGATTTTTGAAGCTCACCA
CGGGGCGCCAGCAAAGGGAGGGAAGCTAGCCAGCATTACATCGCAGAATGCAATATCACGGGTAATGATGCATGGAGAGAAATGGAAACCTGCCGACGAA
CCTGGAAGACAAAGAAGCATGCCCGTGTTGGGAGCACATCGGTCCGGTCCTTTCTTTTTTGTCGAGCTTGAACACAGGCTGACTGATTCTTTGGGTCAAC
ATCCATCTTTGTCATGTGGCTTGACTCTTTTGTTCAGCTTCTTATGTTCTAGCTTTAAGGGTCCACGAGGCCCAGAGAAAAAACTAAAAAAGAAAAAAAA
GAAGAACAAAAGCCTCCATCTCAAACTTGGTTTGCACGTGGATTGTGGGTGCCGACCCGCCCTATGGATGGAGTACCAATTGCACAACGTTACCTTTAGG
AGAGATTGTAAAACAGTTGGATAAAATGATGACAGGTTTTCGTCATATGAGAAGAGACTATCACTTTAAAGGAGATGCCCCAAAAGCAGGCGGATTGAAG
TATCACACAATAATGAACGAATAAGAAGCTGTAGCTCTGCACCCTGCCAGATACCCCACCAGCTGGGCAGCACTATGACATCGTTTTGCAGCAAACAAAG
AGGATCCTTTTTGTCAGAGCCGAGAGTATGGTATGTATGTAAATAAAGAGGATGGAACATGGGGAGGGGCTTGGGGGTAACAGGGAAAAGAAAGAGAGAG
AGAAAAACCCACTCGTATAGAATAGCCGAAATTTGGCAGACAAAGTTTCCGCAAGCGATTCCGCACCCAAAAAGCCAAGGGTTTTTTTTTCTACCGTAAT
GGACCCCTCACGGGGCTAGACCCGACCGCCTGTTGCCGAGAAGAGGCTGGCCTCGCTGCATTATGCAGGGCACACAGCCGCTAAACGTAAGCGGTTGGCT
CCCAAGGGGTTGTTTTTGTTGGCGTGTCTCTCTGTCCCTGGCGATTTTGTGTTGGATCTCGTTTGCAAACCTATTTGTGGTGTCTCAAAATCCTCACCGC
AATCTGACACCGCAGCATGAGCCCTGACCTCATCGTGCTTGACGGGCACAAAGTAAAGTCATATATGCCGCTCGAGTGACACTGCTCCTCGTTTGCATAT
TACCTAATGTAGGTAGGTAGGTACCTGACTGTAGGTACAACTAGGTTTTGTGTACCTCACAGTGTCACCGTTTGCCAGGGTTACAGATGCGACGAAAATA
AAATAAAAACAGAAGAAAAAGACATAAGCCCGAAGAATGCGAGCCAGGTCAGCAAAGAAATCAAAAGCGACTGGGGGGCTGACATGCAGCCCGCGTCCAG
ACCGGTTCTGCTGCAAGGGATTTGACGACTGTTCCTTCAAGGTCTAAAGTACCGAGTTTGGAAATTCATCCCCAGGAGGCGAATCTGGCAGAACATTCGG
GTCGTCTTGTCCGTTCCAGACCGGCCGATGATCGACAAATTGCATACTGGCCTGTGTGTGCCTAGAACAGGTCTGTAAAAAATGAAAAAAAAAGTACAGC
CCCTAAATGGAATGGCATACTCCGTCGCAAAGGGTTTTTCGTGGTGGCGCGACCAATTTGCGATATAGGACATTACAACGTTGCTTTCATTGTTGTTGTT
TACTTTCCGGCGCGTACCCGAGTGTTCTAGACAAAGAAAACTTTAGGGATCCCAGACCTCGGCAAAGAACAAGGCATGAAGTGAGCATGACGACGGGCAA
CCCGCCCACCTCACTAACCTCCAAGCCACAAAACCCCTATGGCGTCGTGAGGGGTCCTGCTGGATTGTGTCATTCTTTTGTCTCTCCTAGGTTTTGGTGG
AGAGCCCTGACCAGCAGCGTGTTCCTGGCGTTTAACGCTAGACGTGCTCGCGACATCCTTCCTCTTTCGTTGGGAAAAGGCTTGATCTCTCTCTCATTCT
CACCTTCGGATGAACGTGCGTGATTCGAATTCAGCCAATGCTCCCCATCAGTGTACGTATACTCCATACGTAGAAGAACAAACGAGAGGGGAAAAAAAGA
GGAGATAAGTCTCATTAATATCATGCAACTTACTTCTCCCCCCTCTCGACTTCGCAAGCACAGATATGCCCTCGGAGGTTTTGTAATATCAGATTAAACT
AGCCTAGAACTAGTAGCAAAACACGACCACTGGACGTGGGTTTGAAATTTAGGGGTTCAAAGAGATCCAATGAAGGGGTGGGTTTCCAAAGGGGATGAAC
GAGTCTCATCATAAATTGCGCCAAAAGACACGGCAAAATATAAGCTGGCTTAATTACTGTACAATCCCAACACCCAAGTTTATCAGATGGCGGGAGTGGC
AAGTAACAAACATCGCCGGTTATACTCCCTTTTTTTGGTAGCCTGATGTGCAGATCCTAATAATATGCTCCGATTCGCAAGGAGCTGGGCAAATCCCCAG
GTAATCCCAAGTTTCAGATAGCAGCCGAGCAATTGGAAAAAGGGGCCGGCTGATCAACGCCGGGCTCCTCTATTTTGCTCTCCTCCGTGGCGATGACAGT
TACCAACAACCACGTGGGTTGGGCGCTGATCAGTTGCCATCATCTCGTTGGTGGTATGAATTGCCGATAGCGTTGCAACGAATTCCCCGAGTTGACTAAT
GGCTATCACTAGAAGATGCCAGGCGGGCTTTGCTTCCCGGAGATCCCGTGCGAGCCTTGTGCAAAGGTTTTTATGGGCTCGGGCTTCGGACTCGAGGCCC
AAGTAAAGTCGGTATTTGTTCCCAGAGTTATCTCCGCGTTGGCAAAACTTAATGTGGTGATATGCAACGGCAGTAACGGCAGTTAGATGCAGGGACCTTT
TACTAGTGAGACTGCTAGCAGAACAAAATCTCGCTCCCATGCACCAAAGGCAAAGCAAAGGCAAAGTAATGTGTACCAGTAAATATAGTCGTAAAAATGT
TATCAATTCAATTTTTTCCAAGCATCTGAATAAAAGGTATCTTCGTAAATGACCAAACGCCACAAAAGGTATCATAAGAAATCATCGCTATTTTCCCCTG
TAATGCAACCAGTGTACAATGCCTTGAAATTCATCAAAGACCAGTCCAAGTCCAGCTAGTGGAATGATGAGCGCAAAAAAAACACAAAAAAAAACGCCTC
GCTTGCGATGTAAATAAAAGAAGGTGAAGTGAAGAAAAAAAAAAGGGGGTAACAGCCAGCCCTAGACAAACCAGGTATTGAAATGAAAACAACGAAATCG
ATTCGTGAAAAATCTGGCTCATGTCCTCCGGAGATACAAAAGTACCCTTGGGCATGTCTCAGCATATGAGCGCTTAGGCAAAGATCGACGTCATTGCCTT
GGCAGAGCCGACCCAAGGGCGGGGCGAAGCTCCAACGCGCAGAATATGGTATGCAAGCGATACCAAAATAGGAAAAACACGACTTTGGAAAACCAATGAG
CACTGGCCATGACGTGCAGTGCCGTAGCAGCCAAAAAGTCCAATTCACTCGACGTTGGGTGACGGGTTGAATAAAAGCTGCATGTGCATTTGGATTACTG
TGGTTGTGACAAAGTCACATGTTTCCACTAGAACCAAATAACAGATGACAGTGGCTTTGGGCGGCCTCTGCTGCCCAGTGGACAACATTGTTGTTTGTCT
CGAGTCATGAATGTCGCTGTTTCCACCTATCAATCCCCTCTCGGGCCCTTCCGAGAATAGAAAAGGTTTGACGATTGGCCTATCGGTAGTCGGATTGCCA
AGATGCCATTCTGGCACGACTGGGCCGAATTGGAGAGTAGCGAATGGGCGAGAGACTTGTCGCCAGCTCGGGCCCGTTGATCGGCATCATGAGGATATAA
CCTTGGTCGTGTTTCAAGTGTTTACCGCCGTCCGTAGCAGTCGGGGCAATTATGCCGCTGATTGACTGCGTCGAGGACAGGGCAAGTCACCAGTGTCGAT
GATCTTGTAATCCCCCACACCTGGGGCGGTGTCGAGATGTGCCCATCGTGTCGGTGAATTGCACTTGGTCCCATCCTACTCCCAAAGAAATGCCCTTCTC
TGAGCTAAGTGGTTGCAAATCAATCAAGCTATCTGAGCTTGCGGATATGGGACGGGGTGAGGTATGTAGGAACGGGAGTAATGATGGCGAGCGAGCCGTG
Copyright 2006 Fungal Plant Pathology Lab. & FBL
E-mail : yonglee@snu.ac.kr
Magnaporthe oryzae ATMT Database