Home   Guide to ATMT Database   Sitemap   Contact  
Sequence ID  5330532
Locus Name  MGG_06765.5
Gene Name  
Protein Name  hypothetical protein
Species Name  Magnaporthe grisea [Magnaporthe oryzae 5 PROTEINS]
Protein Sequence
[594 aa]
+  1
101
201
301
401
501

MSTTSAELLNGANGRINDHDHVLRPRPRKPLHSQLSQISNASDTGSTFDASSEHGASISSGRSTPVPEDAPPSVKILSTARQQVRREQREILRSRRRLFPPTDFESRLSHLDPNSDYRDFHGFFNLFWIGLAIMAITTMLRNIKDTGYPMRVQIWGLFTVKVWELALIDAAMVLSTYVSLPLHRVFRAAPAGSLLTWARGGMAIMSIYEVLWLALWVATPFLLDWTWTAQVFLLLHTMVLLMKMHSYVFYNGHLSETEKRLRALDNPSTASKAPAYLYPSENKVASPKRTTAPKFFRDNKADETSSPLETSTLSKDVDDRVGGDWHVDGEDDDISQLREDLARELTSPMGNTAYPRNLTFSNYVDYLFCPTLCYELEYPRTEKIDWQSLISKIIAVFGCIFLLTIVSEEFILPVLIESSQRLAVPGMSASETILILCETISWLLFPFMVTFLLVFLVIFEYVLGACAEMTRFADRRFFADWWNSTDWMEFSREWNVPVHAFLRRHVYGASRPHIGKPYATVITFLISAIGHEIVMACITKKLRGYGLVCQMLQLPIFALQRTKWIRGKHTANNVFFWCSMIMGLSMMCSLYVLI
PTDFESRLSHLDPNSDYRDFHGFFNLFWIGLAIMAITTMLRNIKDTGYPMRVQIWGLFTVKVWELALIDAAMVLSTYVSLPLHRVFRAAPAGSLLTWARG
GMAIMSIYEVLWLALWVATPFLLDWTWTAQVFLLLHTMVLLMKMHSYVFYNGHLSETEKRLRALDNPSTASKAPAYLYPSENKVASPKRTTAPKFFRDNK
ADETSSPLETSTLSKDVDDRVGGDWHVDGEDDDISQLREDLARELTSPMGNTAYPRNLTFSNYVDYLFCPTLCYELEYPRTEKIDWQSLISKIIAVFGCI
FLLTIVSEEFILPVLIESSQRLAVPGMSASETILILCETISWLLFPFMVTFLLVFLVIFEYVLGACAEMTRFADRRFFADWWNSTDWMEFSREWNVPVHA

DNA Sequence
[1785 bp]
+   1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
ATGTCAACTACTTCAGCCGAGCTCCTGAATGGAGCTAACGGCCGAATAAACGATCACGATCATGTTCTTCGGCCGCGTCCGCGCAAGCCGTTGCATTCGCAACTGTCTCAAATCAGCAACGCCTCAGATACCGGTAGTACCTTTGATGCTTCATCAGAACACGGCGCAAGCATCAGTAGCGGTCGATCAACGCCAGTACCCGAGGACGCTCCTCCGTCGGTTAAAATCCTGTCAACGGCGCGCCAGCAGGTCCGGCGAGAACAACGTGAAATCCTACGCAGCCGTCGACGCCTGTTCCCCCCGACAGACTTTGAGTCTCGTTTATCCCATCTCGACCCGAACAGCGACTACCGGGACTTCCATGGCTTCTTCAACCTATTTTGGATCGGGCTTGCCATCATGGCCATCACAACCATGTTGCGTAACATAAAAGACACGGGCTATCCCATGAGAGTTCAGATTTGGGGATTGTTCACCGTCAAGGTCTGGGAGCTTGCGTTGATAGATGCAGCCATGGTATTGAGTACCTACGTTTCACTACCGCTGCATCGGGTCTTCCGCGCTGCCCCTGCCGGCTCTTTGCTGACCTGGGCCCGTGGCGGCATGGCTATAATGAGCATATACGAGGTTTTGTGGCTGGCCCTTTGGGTTGCCACCCCTTTCCTCCTCGACTGGACTTGGACTGCACAGGTATTCCTGTTGCTGCACACCATGGTGCTTCTGATGAAGATGCACTCATACGTCTTCTACAATGGCCATCTCTCAGAAACCGAGAAGCGATTGCGCGCTCTTGATAACCCTTCAACGGCATCCAAGGCACCAGCCTACCTCTATCCCAGCGAGAACAAGGTGGCTAGTCCTAAGCGAACAACGGCTCCCAAATTTTTCCGAGATAACAAGGCGGACGAGACAAGCAGCCCCCTCGAGACTTCTACGCTCTCAAAAGACGTGGATGATCGCGTAGGGGGCGACTGGCACGTCGACGGCGAGGATGATGACATTTCACAGCTCCGTGAGGACCTTGCGCGTGAGCTTACCAGTCCTATGGGAAACACGGCTTACCCGCGCAATCTAACATTCTCCAACTACGTCGACTATCTTTTCTGTCCTACACTGTGCTACGAACTCGAATATCCGCGCACCGAAAAGATTGACTGGCAGTCACTCATTAGCAAAATCATCGCTGTCTTTGGTTGCATCTTTCTTCTGACCATCGTCAGTGAAGAATTTATCCTGCCTGTCCTGATCGAATCGTCCCAACGCCTCGCGGTCCCAGGCATGTCGGCATCTGAAACCATTCTTATCCTGTGCGAGACGATCTCGTGGCTCCTCTTTCCGTTCATGGTCACATTCTTGCTTGTCTTCCTGGTCATCTTTGAGTACGTACTGGGTGCATGCGCCGAGATGACACGGTTTGCAGACCGACGCTTCTTCGCCGACTGGTGGAACAGCACCGACTGGATGGAGTTCTCACGTGAGTGGAACGTGCCCGTCCATGCCTTCCTCAGGAGGCACGTCTACGGCGCAAGCAGGCCGCACATCGGCAAGCCATATGCGACTGTCATCACCTTTTTGATCAGCGCCATCGGCCACGAGATCGTTATGGCTTGCATCACAAAGAAGCTGAGGGGTTACGGTTTGGTGTGCCAGATGTTGCAGCTGCCCATCTTTGCCCTGCAGCGTACAAAGTGGATCAGAGGAAAGCACACAGCCAACAATGTGTTCTTCTGGTGCTCAATGATCATGGGCCTTAGCATGATGTGCTCCCTCTATGTGCTGATATAG
AACTGTCTCAAATCAGCAACGCCTCAGATACCGGTAGTACCTTTGATGCTTCATCAGAACACGGCGCAAGCATCAGTAGCGGTCGATCAACGCCAGTACC
CGAGGACGCTCCTCCGTCGGTTAAAATCCTGTCAACGGCGCGCCAGCAGGTCCGGCGAGAACAACGTGAAATCCTACGCAGCCGTCGACGCCTGTTCCCC
CCGACAGACTTTGAGTCTCGTTTATCCCATCTCGACCCGAACAGCGACTACCGGGACTTCCATGGCTTCTTCAACCTATTTTGGATCGGGCTTGCCATCA
TGGCCATCACAACCATGTTGCGTAACATAAAAGACACGGGCTATCCCATGAGAGTTCAGATTTGGGGATTGTTCACCGTCAAGGTCTGGGAGCTTGCGTT
GATAGATGCAGCCATGGTATTGAGTACCTACGTTTCACTACCGCTGCATCGGGTCTTCCGCGCTGCCCCTGCCGGCTCTTTGCTGACCTGGGCCCGTGGC
GGCATGGCTATAATGAGCATATACGAGGTTTTGTGGCTGGCCCTTTGGGTTGCCACCCCTTTCCTCCTCGACTGGACTTGGACTGCACAGGTATTCCTGT
TGCTGCACACCATGGTGCTTCTGATGAAGATGCACTCATACGTCTTCTACAATGGCCATCTCTCAGAAACCGAGAAGCGATTGCGCGCTCTTGATAACCC
TTCAACGGCATCCAAGGCACCAGCCTACCTCTATCCCAGCGAGAACAAGGTGGCTAGTCCTAAGCGAACAACGGCTCCCAAATTTTTCCGAGATAACAAG
GCGGACGAGACAAGCAGCCCCCTCGAGACTTCTACGCTCTCAAAAGACGTGGATGATCGCGTAGGGGGCGACTGGCACGTCGACGGCGAGGATGATGACA
TTTCACAGCTCCGTGAGGACCTTGCGCGTGAGCTTACCAGTCCTATGGGAAACACGGCTTACCCGCGCAATCTAACATTCTCCAACTACGTCGACTATCT
TTTCTGTCCTACACTGTGCTACGAACTCGAATATCCGCGCACCGAAAAGATTGACTGGCAGTCACTCATTAGCAAAATCATCGCTGTCTTTGGTTGCATC
TTTCTTCTGACCATCGTCAGTGAAGAATTTATCCTGCCTGTCCTGATCGAATCGTCCCAACGCCTCGCGGTCCCAGGCATGTCGGCATCTGAAACCATTC
TTATCCTGTGCGAGACGATCTCGTGGCTCCTCTTTCCGTTCATGGTCACATTCTTGCTTGTCTTCCTGGTCATCTTTGAGTACGTACTGGGTGCATGCGC
CGAGATGACACGGTTTGCAGACCGACGCTTCTTCGCCGACTGGTGGAACAGCACCGACTGGATGGAGTTCTCACGTGAGTGGAACGTGCCCGTCCATGCC
TTCCTCAGGAGGCACGTCTACGGCGCAAGCAGGCCGCACATCGGCAAGCCATATGCGACTGTCATCACCTTTTTGATCAGCGCCATCGGCCACGAGATCG
TTATGGCTTGCATCACAAAGAAGCTGAGGGGTTACGGTTTGGTGTGCCAGATGTTGCAGCTGCCCATCTTTGCCCTGCAGCGTACAAAGTGGATCAGAGG
Position in Contig 2087257 ~ 2089196 (1940 bp, 155 bp) in Magnaporthe grisea 70-15 supercontig 5.186 (Strand -) (Frame : -1)
Chromosome Chromosome : Not defined!
Contig Sequence
(2077201 ~ 2099100)

+2077201
2077301
2077401
2077501
2077601
2077701
2077801
2077901
2078001
2078101
2078201
2078301
2078401
2078501
2078601
2078701
2078801
2078901
2079001
2079101
2079201
2079301
2079401
2079501
2079601
2079701
2079801
2079901
2080001
2080101
2080201
2080301
2080401
2080501
2080601
2080701
2080801
2080901
2081001
2081101
2081201
2081301
2081401
2081501
2081601
2081701
2081801
2081901
2082001
2082101
2082201
2082301
2082401
2082501
2082601
2082701
2082801
2082901
2083001
2083101
2083201
2083301
2083401
2083501
2083601
2083701
2083801
2083901
2084001
2084101
2084201
2084301
2084401
2084501
2084601
2084701
2084801
2084901
2085001
2085101
2085201
2085301
2085401
2085501
2085601
2085701
2085801
2085901
2086001
2086101
2086201
2086301
2086401
2086501
2086601
2086701
2086801
2086901
2087001
2087101
2087201
2087301
2087401
2087501
2087601
2087701
2087801
2087901
2088001
2088101
2088201
2088301
2088401
2088501
2088601
2088701
2088801
2088901
2089001
2089101
2089201
2089301
2089401
2089501
2089601
2089701
2089801
2089901
2090001
2090101
2090201
2090301
2090401
2090501
2090601
2090701
2090801
2090901
2091001
2091101
2091201
2091301
2091401
2091501
2091601
2091701
2091801
2091901
2092001
2092101
2092201
2092301
2092401
2092501
2092601
2092701
2092801
2092901
2093001
2093101
2093201
2093301
2093401
2093501
2093601
2093701
2093801
2093901
2094001
2094101
2094201
2094301
2094401
2094501
2094601
2094701
2094801
2094901
2095001
2095101
2095201
2095301
2095401
2095501
2095601
2095701
2095801
2095901
2096001
2096101
2096201
2096301
2096401
2096501
2096601
2096701
2096801
2096901
2097001
2097101
2097201
2097301
2097401
2097501
2097601
2097701
2097801
2097901
2098001
2098101
2098201
2098301
2098401
2098501
2098601
2098701
2098801
2098901
2099001
AGAGGCATGCAAGGCATTGTATCACACAGTCACAGGCAACTTTTGGCGGCTGATAAAGGGACTATTTGGTTAGCCCCCCTGCAGCTTGCATCCTGCATAG
CGAATACTGGCTTTTTAGACTAGTGGTGCGGCAAAAGACCCCAGTAGTCTGTGCATGCGGAGGAACTACGGTACAATGTGCATAGGGGAAGCCCCTCTGC
ATGCACCTTGGCTGCCTGTCAGCCTATCTTTGCTGTATGTATGTTGATGTACATACCTACCTACATGTACAGTGTTATGTGCGTGGTTGTTGACATGGGGGTCACAAACAGCTACGTAGCTTACGTAGTTTTCTCCATCTTGACGGACACACACAAATACCGGTAAATGTGAATCATGTGTTGCGCAAATCAAGCAGAGGTTAACAGTATCAGAGGAAATGCTTGAGTCCATTATTATCGCTTTAAACCATCACCCGGTAAGCCTCTCTAGAGATGTATCGTCATCTCCATCAGCTTACACACCATTTTACACCGCAGACTATCTGCTGCCGAGATCCTATACTGCCTCTTTCTGTCAGGTTACGCGGCGATAGTCACTGCACAGCCCTTGCAGTGACTAATGACGCCTGCCTCCCATTCGCTGCGGCCTGAGTACCTCCTAAGAGTCGCCTCCGCCACAGAGAACCCGAGCTGAACGAGGTACCGTAACCCCCCCCCCCCCCCCCCCGCCGCCGCAGGGATTACCTGCCTGTAGGCCGACGTTTTTGGAAGGTCTGACCACGGACCACAGCTGACGGGATGGCAGATGGCATATTGAAAAGAAAAGAAGAACAGAAAGACCACCTCCGGCTCGGAAGGAGGGGTACAGAATGTGACGGCGGGGTTGAGGTTGAGGTTGGCGGAAACGGTTGGTCCAGACTTTTGGGCCCCGCGCCCAGAACGCCCCAGCTGAGCCAGACCCGGCTGTCGTCATTGGTTCGTGACGATCAGCAAGGAAAGGCTCTGTCACTCTAATTCCCACTCTTTACTCTCTTATCCTTGGGACACTATTATTATTTGATGCTTTTTTTCGGTAGGTAAAAGTACGGCCGTCTTGTCATATGTTAATATTTCCCTATTTTATAGCCGATCTTCTTGCAGATCGCTCGACTAAAGCACCCCTTTACTCCTTTTTCATACTGTAGCAAAGGCCGCCCTTTTGAGAGACTTTTTCTACGCTCATCGAGAGAGCCTAGCGTTCAGCCAACTCGATGTACCCCTGGGTGACCAAAGCGGGATGGTATGTGCTGTAGAGCCCCGCATTCTCTTTTCTTCCGTGATCCCTACCTTATCCAAGACACATTACGTAGCGTACTACAGTAACTTGCCCGAGCTTACTGGTAGTCCTTGGGACCTGCTGCTTGAGATTATGGTCTGCGGATAGTATTTTTGCTTGCAAGTAGCCTAGAGCTAGCTATCGTACTTCAGGGCTAAGGCATATCGAAATCCTCGACATAGGTAATGGAACTGGAGCTGAAGAGAAGCACGCACAGTGGAAAGACGGATATGACCCCTCAAAAGCTTGGGACTGCGAAGAAAAGAAAAAAAGAAAAGTATTGACGCAAGTCACTCGGGTCCAGCGTTTTCGACGATGCGTAGATCCAGGCTGCCCCCGCAGGTCATGGGCTTGACTGAGAATAATACCGACGCTTCCCAAAAAGCATCACCAACCTTGCAAGATTTCTGGGTTTGCTTAGTTGATTGGTAGCCAGGTTTAGGGCCTCCCACATGGTCACGGGAGCCAAGCTAGGTGATCAATCAGAGAGCCGGTCCCACGCGGTGGATTGAAGCTTGGCACTGGTACCTTGAACCGGCGGGTGCGCATTGCAGAACCGGATGGGGTTTGACGAGGGATATGACCATGCTCTCCTTGGTCTCAGGGATGCGCATGGAGATGCCTTGGAAAAAAGGGCAAATGATAGTACGTTGTAAGTTGCTGGATTATCTTGTGAGGTGCGAGGTAGCAAGTGACAAGCTTAGATTCCGACAAAACCTAACCGAACAAACCCGTATGCGACCCATGGTTATGCGCAGTTTAACTTCTGTCACTGAATCTATTATACCGCAAACTTTCGGGGTGGGTTTGCGTTGCGACGACACGAGACTGCGGGTGGCGTTGCCAACAGCGGGGCGGCGAACGGGGTCCGTCCTGGCTTGCGAGCGGATGAACAGCTGAATTGGCCAACTGTACAGGCTGCGTTGCTGTGTGAACTACATAGCCAGCCTGAAGATGTTTTCTTTTGACAATTGAACATAGCTGCGTAGTAAGGCACAAGGTAGTGCAAACTCAACAGTAGCGGTCAAAGTTGCCCAGGCAATTCGCCCAATTGACCCGTTCGTCAACGGCACTCTGCCTGGTACAGTAAAGCTGATCGATCTGGTCCCCCGGCGGGGGAACAACGGAGATCTACACAGAGCTCCTACCGATGTGGGCCATGATTCCGTGCGAGGAAAAAGCATGTGGGCAAGGGTAGCTCCTGCTGATGCTCCGATGGCCCTGACCATGGGAGATAGAGCTTGCAAAAGCTGTTGCTGGTCTGCTGCAAGGCCTGCAAAGAATGGGCCCGGGGACTTGGGGGATGATGCGAGACTTTGAAGGTTAAGGTCATACTAAGTGTTCACCCGAAGGCGTATACACCCTGGATCGGCTAATCGCTATTTCGTAAATCCATGCGGTGCGTGTGCGACCATGAGAAAAACAATCAAAGGGTTTTGATTTCGTGGGGTGACAGGAAACCCGATCTTTACTGTAAGACCGACCGATTTTCGCGTCCTTTTGCTGGTTGCGTGACCCCTAGAGATCGAAGGGGAAGACCAGACCATAGGTACAGTATATCATAAGAACAAGCTTGCAAAACAAGTCAGACGTCATGTTATTATCCCCGTTAGTGCCAAGAATGGTGGATCTGCCTACTACAGTGTCCATGGCTCACAGGTCAAATCTGGAGCTCGTTCCAGTCATCACACACAACCCGTTAGGAGTTAGTTGCAGAAACCCATCCCGAAGACGCCGCACAAATCCACAATCATCCTTCGCAACAAGCGACGCATCCATTGGGGTCCCTCTAAACCCATTTGGCGATACATTTTGTGTACTGAGTAAGGTATCATGGCTGTGGACTCGAAGGGCTCGTTTAACACATGGCCGTCACCGCTATTGTCGTTGCCAGGACATCGTTGCTCCGCAGGACCCATTAACACTTGGCTGACTTATCACGTCAGTACTGTACGGTACTTTCTAACTTTGTAAAAGAAAAGGAGCATTGTCGGCCTTGTGGGAAACACTAACTCGAATGTTATCATGGCACCAGATGTCAAACCCGTCGGTTTACCATGTCAAACTTTTAGCAGGCGGTCGGCAATATTCAACACCCCGATTGAGCATGAACGGTTTTACGAATCATTCCTGAACCCTTGCAGGCTTAAGTGATTCAACTTGTGTAATCCGTGACGGGCGTGAAGGGGCGCTTGGTAATACGGACATGACCGACACAAAGTATCATTCGGCCTTTCTGATGTGCAAGAACCGCCACTATCGACAAGCCAACAAGCCCTCAAGGGACGGGTACAGCCATGGCGTCTATGCTAAATAGATACTTGATTGTCCTTGAAAATCCATCTCCGTGACAGTCTGATGAAGATCTCTTGCTATCTACCTACCCCTGATAATCAGAGACACTAGAATTAAAACCTGTACCTTTTCATCCTTGCCCCTTTGTCCCGTCCATTATAACCCGCCTCAACGGCCCCGGGGCGTTTTGTAACTGACGTTTTGGCGTCTCGGCCTAGACGCAATCCGGTCAAGGACAAGAGCCCCCGCGCGAGGCTGTGATGGTCTGTGGCGGCGCCCGTCGATATTTGCGAAACGTGCCCTGAGCAGGAGACCACACTTCAACGCCACACACGCGTGCAAATCTCAACGAGGCCAGGCACGCGAGCCTTCCTAGCTTGTATGGTGTGGTTCGCCGCCATCTTTTTTTTGGGGGGTTTATTCACTCTGTCAGGGCAAAGGCCAGCTACGGCGGCGCTGTGCCGTGTCATCACATCCTCTCTGCCCACGGTTTGGAGGGGTTGGGAATCAGTTGCACCGAGAGGTCTGCCTTGCACGAGCCAGTCGTGGGTCGTACCCGATCTGTAAGGGAATAAGGCTCCTGTCGGAGACGACCTATTTGCCGACCCACGACGAAAACATCGCCGAAAGGCATCTCACTCTGTCGCCAACCTGCTTACGGGACACTCCCCTCCCAAAAGTTCATTTTATCACCTGCCTGCTCCTAAATCCTGGGGAATCCGACGCTTTTCCAATTTAGCAGCAACAAAGGTATGAATTCCATACCTTTCTGTTCTTAACTTCACTGCCTTGCTGTTTCCCGTACATCATCGCCCAGCGTGGGGTGCGAAAGCTCCTTCTAGCAAAAATTGGTGGGGCTGCAGTCAAGCGACTGGGATTTATTGATCTCCATGTCAAGAGGTCCTCTGGGCAAGACCGCGAGGCATGTGTCGCACGGTGTGAATCCCACCCGATCCACTTTTTGCTTTCCTGCACAATCGTCTGGCTACAAATAATCAACTACTGGGGTGGCCAAGGGGCCCGCCCCATGTTGTCTCCGCTGTTAGCGTCATCAACGGACCATTCAAAGGCCCTAGGATTGACCCTCGCCTGGGATTTCAGAGACTCCAGTTTTTTGCTTCGCACGCCTGCCGTTGTGTGGGCGCCCGTCAAAGAGGAAGTAGAAGCGGGCGAACGCAACTCAAGCACGGCGCAGCCAACCACGAGCAAGGGCCCCGTCTAACTTGGGCGGCGGCCAGTCGACACCGCAACGTCTCTTAGAAAGCCTCATCCTCGCACCTTCGTCCCGACCAGGTTGCCTGACTTTCACTTGGGACGGTCGCTCGAGCTTCGTCTCTTGGGCACCACTTTGTGCATGCATGCATGACAGATGCCAACAACCTCGTTGTTCTTTGTTTTGTTTTATTCTACTATCACGCTTCTCTTGATTTTTTCTCACCACGATAAAGCATCCGATTCTTGCTTGCTACAACGAGCTGTCTGATTACCTACCTTCCCTACCTCGGCCTCTTCTTACCTTTGAATCGTACCATACATTCTCATACATTCATATCCATCTTATGAATCTTCACATGTACATTTAATCCTCGCCTCCTCTGACCGACCATTCATTCCCTTCTATACCCTAGCTTGCAACCAACCGGTGCCGCCCCTTTTCTTCTTCTTGCCACACTGGAATGCAACACGGCCAATAGCTACTTGTACAACCTCAAACCACCCAAACCCACCTTATACCAAGCCAGCCTACCGCCTCAAAACGCCACTGTGGGCCCTTTCTCTCACGTCTACCGTATAGACCGAAATCAGCAATACGCTCCCCTGCGACTTCTCCAATTTGCTACCACTTCGAGAGAGCTGTCGTGAGAGCTCCTCTCCCTGGTTCACCCCCAGGAGCTTAACAGTTGAATATTGCTTCCCTCACGCTGGCGTCGACTGAAGCATCAGACGCAACTCCGTCCAGTCGCATCGTAGCGCATACTCGCAAACAGTTTTCTCTCCAACATGTTAGAACCGTTACCTCCGGATCCGTACAAGGCGCTCGACATCCCTGCCGATGCCCAGTTCGATGTCATCAAGAAGAGGTATAGGGAGCTTGTGCTGAAATGCCACCCAGACAAGTGCCCAGGGGCGGATAAGGCGGCTGCGACCGACAGGTTTGCGGCCGTTCAGAACGCATGGGAGATTCTGGGAGACGCGACCAAGAGGCAAGACTACCACAAACTCGTCAAACAACACAAGCTGGCGGAAGAGCTTGCGAGGAGTACTCGCCAGGCACCAGTACCTTCAGCCAGCCGTGGGCCGTCATCGAGCGGATACTACGGAACAAGCACATATCACTCATCACCCCAGACACCTTACGGATTCTCCAGGAGCGGCTCCAGCAAGACTCGCTTTGAATATGAATCCCGCCACGCATCAGCACCTTCATTCTACGAGGCAGATCCACGGAGCGGCCCGCATGCTTCGAGGGAACCCCGAAGACCCAGCTCCTGGGACGAAGACCGCTCACGCGAGACAGATCGATCCGCTCGCGATAGGGATAGGGAAAGGGAACGCGACAGGGAACGGGATCGTGGTAGGGGAAGCCCACCAAATCGTGACCGCGAAAGAGAGCGCGAAGAACGCGATCGCGAAAGGACACGGGGCATAAAGCGGGATGAAGACGAGCGCCAACGAAAGTTGAGAAGCAAGGAGGCGAAACGTGAAGAGAAGGAACGAGCCAAGGAGAACGAGAAGGCGGCCAGGAAGGAAGAGGCACGTATCCAAAAAGCCAAGGAAGAAGAGAGGCTGAGGAAGAAGGCGGAGGCAAAGCGAAAGGAAAAGGAAAGGGTAAAGCAGGAAAGGGATGACGAAGAGAGGCGCGCCGGACGAAAGCAGAAGATGGAGATGGAAGCGGAGATCAATATACCACTAAGGGAAAAGATGAAGAAGGCTCCTGTCGAAGACGAAGGTCGCTCAAAAAAGACAACCGTAACGGAGGATATCCGCAGCTTCCCCGAAGACTTTCCCAAGAGCGAACGGGAACACGAGAGACACAGCGAGAGGTCGAGGGACCGTGACAGCGGTCGCACAAAGGAGCAGCGGCGGTCATCGCGTAGCGAGTCTAAACGGCAGAGCTCTCATCCTCGCCGGACCACCTATTTCGAGGATGCACCGCCTACTTCGTCTCGATCCTTGGAGGATTCCGCCTTGACCAAGACCCAGAACCTGCCGCCCAAGTCAAAGACCCAACTTGAAGCGGCTTTATATCGCATCTCTGCAAACGGCGGGTTGCCCACACAGTCACGCCCGCACGTCTCTTATGCAGATCATGAGATACATGACTCTGCAGACTATAATCATCGTGCCCCAAAGCTTCACAGATCAGCTACCGACCATATTACCGGAGACTTTGGCTCTCGTCCCCCAAAACTTAGCCGATCTGCCACTGAGAAGGTCTCATCTCCGCGGCGATCCTATGAGCCCGACTATGACGGATATGGAGGCACTTCTCCCAGTCGCTATTACGATATCCAGGGCACTCCATTTGGCCGTGCAAAGTTTGGCAACGTTGACACGCGGAATCCGACCACTTCCAGCTGGGGAGGGCATGTTGCAACATCTCAATGGGAAACCCCTCCTGAGTATTCATCATACATTCCGGAAAGTAGGCCGGCGAGATATCGCACCGCGGCGGCGTCTTACGACTATTGAGGCAACCAACCAATGTCGTATGGAGTTGACTTCTGCAGCCCGTACGTCGAGTGAGCATTAGCAAGGCTTTGCTTAGTGTGTGGCCGTGTCAAGGATCTGAAGGCGGTCTGTTGGTTTGGAAGCTGTCTCAACGCGTGTTCTAACTGGCTGCGGAAGTGGTCGTGGGCAGTAGTATCCTGGCCAGTGTTTGTGGTGCATATATTCGTGGCGGTAGCCTATTGGATATTTTGTTTTTCCATCGTGATTTGGATCTGGAGTATCATAGTGAGTGGGCATTTTCGGTATGTTTGCCTGGGTGGCACTGTTTGTTTTCTGCGTGTACAACTGGTCTCTTTTTTCTTCCTCCTCTTGGTGTTGCAGTCATAGCAACGCTAGACACTATCCGGTTTGATTTAGATATCATATCCGTAAATCATGATCCACCCGTCTGAATGGGGGTATCAGCAAACTTACACATGGCGCAATGTGTGATTTCATGTGACCCGGGCTTATGCGGTATTATTTTCGATCGAGATATACTCGAGTAAACACCCTTGCGGATAGGGAAAACTCGGGAGTCTGGAGCTTGTGCACATGACGGGTGAGAAGCTAGCAAGGTTAGGCAGGTGAACGGGAAGAAGAAGAGCAGCCAGACCGCCAGTCCTCGCTCGGTATATAAGAAAATTCCCCTACCACACTTGCGCCACTGACGTGAGTCCCTGTAAACCTGCCGCTGCCTTGATTTTTGGATCTTATTTTGTTCTATAAGGACCCTTTTCACTCTGGATGTCTGCCGCTCTGTGAAAGCCAATCCCGGTTTTTGGTTCTCGGGGATGATCTCGGCCTGACGTATCTTTCCATCCAACAGCGAGGCTTTTTGTTGTCCAAGGCACAGCGAGAGGCAGGTGGCGACCTGGCACTCAGGAGCCGACCGACCTTGTTTTTTGGAGGGTGGGGTTCGGGACTCGTTGGGGGTTTCCAGGTGCGCAAACAATAACGGTTTGGCTATCAGAGTTGGTGTTGACCAAGACCCTGGATTTGTCGGACAGGATAAGAGCAAAATGTAATTGATTTTGGAAGGTAAGGATTAGACCCAAGTTGTGAAGTTAGGGGTCAACGAGCAGGGGACGACGTGTACCGCATCTAGCCAACTGATTTCTTCTTCTACTTCTTCTACTTCTTGATGCTTTGTCTTGCTCTTTTGCTTGTCGCAAACCGACTCTCCGCAATAAATAACTCTGACACTTTAACCGTCGGTGCGGGTACCTACCCTAGCTGCGTTCCAATACCAGGCCAAACAGCGACGCTCGAAGAGCCGGTGTGGTGGAATTCCGATATAGGTCTAGATACCCTAGCCATGGAAAAGTCGCAGAATACATGTGCAGCTTTGTTTAAATATCGGGAGGGTTACGGAATACTACTATCCGTATAGTAATGCGCGTTGCTTATGCGTAGATGACTACCTACATCAGTGGATTGCCTAGCCTCATCGTGATGCAGTGTGGTCGATAGACGAAAAGTGGGCATGTATTGGGATGAGCTAGCACGCACACAAAGATTGAAATTATTTTTACAGAATGGTGAATCTTGGCTTGCTGCCCCGACAGCCACAGTACCAGCGAGCTTTGCCACTTCGGAAAAAGAAAAGCAACAAACCAGAACTTAAAATGCGCCGGCAACCTTTGCGAACTTCAAGGCTGAAAAGTAAAAGGGAGTTTGAACTTGTCGATAAAAGGAAAAAAAGATACGATCTCGGATACGGGGAATCGAACCCCGGGCACGACGGATCCTGTTGAGGATTGAGAGCGTCGTATGTTAGCCACTACACCATATCCGATGTGGAACTTGTTGAACATATGAGAATAAGTTAGCCTTATCAATAGTTAGCAATCTGGAGATGCCAACGCCCGCGATACTCTCAACATTTTGGGTGGCATAGTGAGATGGACGATGGGTTCAAAGAGTCTACCGGATATTATGGCTCGGTGCAAGTCTTTTCCCCAAGTATCCGGATGCGGGTTAAAGAGCGATACCAGAGACTTACGTGTTTGTCTAGTTCTAGTGTCGAAGTTCGGGTTTGTTGGTATCTCTCTCCTCTGCATATCTGTCTTTAGTAGTGTCACTATGGATGCAATCGCAAGATAACAATAATACCCCCATTCGATGCTACGCTCTTGGAATAGTTTCAAGACGAATTGTTGTTTGCAGGAAACCACAGTCTCTTGCACTTCGTAGCCAAGTCTGCAAGCTGTTGAACACCGAGTTTTTAATGCCTTTGGTCTACTGCCAGCTAAAGCTATCGCCGGGAAAATTTCCACTGTGGCATGTCGCCTCCTTTTATGCTCGTATCGGAGAGCATTGCCCAGAAGTAGATTGTTCAAGCTTCCATGCCATCTAGCCATGCAGTTTCGACTTTCTCAGCGAAAGTTGTTTGGATGGATACATATTCATAACGCTTGCTTGTTATGTTATTTATTATACAACTATTTAACAATGATTCACCTGCTCACTCAGCACAGACAAAACGTGGGCTCCTGATACTAGACCTAGGTAGGCTTGAAGCTGATCTAGAGAAGAGAAGTGGGTGCCTCTTGATGAAACTACCTACAGTACAAATGAAACCTCCCAGGGGTATTCGTAGGCTGTATCCTAACTCCAACAGAAAAAAAAGTACATTGATGAAAAGTGACAAGCGGTGTGTTCTTGCCGTAACATGAGAACTAGAACTACAGGAGGCAATTCTGGTCAATATGTCAAGTTGTTCGCAGCAACAGCGAAAAACAAGTTCAATCGCTATATCAGCACATAGAGGGAGCACATCTATCATGGAAAAAATATATCTTAGCATCCCATTTGATTGTCATCATCTTTGCGATTGGGAAAATGGAAACTCACCATGCTAAGGCCCATGATCATTGAGCACCAGAAGAACACATTGTTGGCTGTGTGCTTTCCTCTGATCCACTTTGTACGCTGCAGGGCAAAGATGGGCAGCTGCAACATCTGGCACACCAAACCGTAACCCCTCAGCTTCTTTGTGATGCAAGCCATAACGATCTCGTGGCCGATGGCGCTGATCAAAAAGGTGATGACAGTCGCATATGGCTTGCCGATGTGCGGCCTGCTTGCGCCGTAGACGTGCCTCCTGAGGAAGGCATGGACGGGCACGTTCCACTCACGTGAGAACTCCATCCAGTCGGTGCTGTTCCACCAGTCGGCGAAGAAGCGTCGGTCTGCAAACCGTGTCATCTCGGCGCATGCACCCAGTACGTACTCAAAGATGACCAGGAAGACAAGCAAGAATGTGACCATGAACGGAAAGAGGAGCCACGAGATCGTCTCGCACAGGATAAGAATGGTTTCAGATGCCGACATGCCTGGGACCGCGAGGCGTTGGGACGATTCGATCAGGACAGGCAGGATAAATTCTTCACTGACGATGGTCAGAAGAAAGATGCAACCAAAGACAGCGATGATTTTGCTAATGAGTGACTGCCAGTCAATCTTTTCGGTGCGCGGATATTCGAGTTCGTAGCACAGTGTAGGACAGAAAAGATAGTCGACGTAGTTGGAGAATGTTAGATTGCGCGGGTAAGCCGTGTTTCCCATAGGACTGGTAAGCTCACGCGCAAGGTCCTCACGGAGCTGTGAAATGTCATCATCCTCGCCGTCGACGTGCCAGTCGCCCCCTACGCGATCATCCACGTCTTTTGAGAGCGTAGAAGTCTCGAGGGGGCTGCTTGTCTCGTCCGCCTTGTTATCTCGGAAAAATTTGGGAGCCGTTGTTCGCTTAGGACTAGCCACCTTGTTCTCGCTGGGATAGAGGTAGGCTGGTGCCTTGGATGCCGTTGAAGGGTTATCAAGAGCGCGCAATCGCTTCTCGGTTTCTGAGAGATGGCCATTGTAGAAGACGTATGAGTGCATCTTCATCAGAAGCACCATGGTGTGCAGCAACAGGAATACCTGTGCAGTCCAAGTCCAGTCGAGGAGGAAAGGGGTGGCAACCCAAAGGGCCAGCCACAAAACCTCGTATATGCTCATTATAGCCATGCCGCCACGGGCCCAGGTCAGCAAAGAGCCGGCAGGGGCAGCGCGGAAGACCCGATGCAGCGGTAGTGAAACGTAGGTACTCAATACCATGGCTGCATCTATCAACGCAAGCTCCCAGACCTTGACGGTGAACAATCCCCAAATCTGAACTCTCATGGGATAGCCCGTGTCTTTTATGTTACGCAACATGGTTGTGATGGCCATGATGGCAAGCCCGATCCAAAATAGGTTGAAGAAGCCATGGAAGTCCCGGTAGTCGCTGTTCGGGTCGAGATGGGATAAACGAGACTCAAAGTCTGTCGGGGGGAACAGGCGTCGACGGCTGCGTAGGATTTCACGTTGTTCTCGCCGGACCTGCTGGCGCGCCGTTGACAGGATTTTAACCGACGGAGGAGCGTCCTCGGGTACTGGCGTTGATCGACCGCTACTGTGACGGGATAAAGAGTTAATTTTGTCCAGTTTGATAAACCATGACAGATATGACCCAACTGCTCAAGAAAAGCTTACCTGATGCTTGCGCCGTGTTCTGATGAAGCATCAAAGGTACTACCGGTATCTGAGGCGTTGCTGATTTGAGACAGTTGCGAATGCAACGGCTTGCGCGGACGCGGCCGAAGAACATGATCGTGATCGTTTATTCGGCCGTTAGCTCCATTCAGGAGCTCGGCTGAAGTAGTTGACATGGTCTTAAGGGTTGGCGGCAGGTTGATAATTCAAGGCGGAAGCATGCAACGAGGTTTCTGCAGCTCCGTTTCCTTGGGCGCATACACCAGACGGATGAAACAAAAACCGGCGTGGGGGAAACAATAGGCTAAAATAGCGCGGGAACAACCAAACCAGTTTGGCGTTTGCACTCGCTGTATCCAAGAGCTACTGTAGAAAGCTTGCCAGTTGATCAAGTCTTGGCACCGTTGGCTGTCTTATTTTTTTGTGAAACAAAACTGGAGAGGATACCACGAATGACGGATTCGACGGAACTCGGCCCAGTTGGGCGTTAGTTATATAAAAGTCACGACGGCCGAAGCGGGGTCGCTTATTTGTCCGAATCTTTGTTTTGACTTTGGTGCAAATATCAGCAAGGGATCGATGGGCAGTGAGATGCAGTCACCTTTTTAGTTCTAGAAATAGTACTGTGGTGACGGCTGCGCCATCTCCAAGAGCAGCTGTTCGTGGGCTGTACTGTAAGGGGTCCTTGCAGGGGGTCGAGGTGACGGTGCTGTGGTATCGTACGTGCGTCATTACACAGTAAACCAAGACTTTGGCCTGCGCTGATTGGTACAGTGCGCGACAGCGCCAAAACGGACCCACGGAGCTCCTCGGCATTGCGACATGGGCCTTGAGATAATAACCAGCACCTTGTATCTACTTCGTAGGTATCTACTTTGAGAAGACCGCTTGGCGGTACTTTTCTCGTCTCCGCATGCCGAAGTATTTACGAGCTGAGATCGCGATCCCAAGGCTGGTTTGGAATGGGACTATTTATCTTGGCTGTAATGAATATAAAGCCCATCACATATTCGGTGGAGGATACGGTCTAGTTTAGAAGCACCTACTTTGTAGGTTATGCACAGCACGGCGTCGGTAATGTAAGCCGTTAGGAACTTGATATTGATTGCATGCATTCAGCAGGCCGTGTCCTGTACTCCCTGGCTTGGAACATACGAAGTAAATCGACTGCCATTCTCGTAGGCCCATTCACGAAACCGAGCGGCGGTATGGTGAAGTGTAATTTTTTTTTTATCATGAACAAAATCGAACTCTAAGAGATTATGGCGGTTCTCAGTTGCACATTAGTCGCAAATAGTATCAAGTCGCCATTATCTTACTAGAGCAATTGCACATGCTAGGAATACTCTGTCAAGTCCCGGGTCAGGTGGTACGGACTTTGTGATAGTAATGCTCTCTAGCCAAGACCAAGTAAGTACTGTGCCAACCCAGTTCCCCCAAGTCAACCTTCTCGACTTGAACGAAAACCAAGGCCCCACGTGACGTCAAATTACTCAGTCCCGTCCTGTCCCCCATCACCATTTGCTAGCTATTACCTACCTACCTACTGCAGTAAGGTACCTACCGCCCTAGCTCACTTCGCACCACCCCTCCGCTGTCCTGCAGGCGGGCACCGGTCCCTGCCTTAGAGATCCCGCACGCGGGGCATGTCGAAACTGGGATTGCCGGGCTTGTTCCGCCCCGCGTCGTCGCTCCTTCGCAACGGCTGTAACACCACACCCTTTTGCAACCTGCCTAGACACATAACCCGCACCGCGTCGTCGTCGCCGACTTTTACAAACGCCAGAATGTCCTCCACACAACCCACTGACCGCCGCCCCTTGGTCATCTGCGGTCCCAGCGGCGTCGGAAAGGGCACCCTGATCCAGATGCTCTTCCAGCGTCACCCGGAAACATTTACCCTTTCCGTGTCGCACACGACGCGCGCGCCGCGCCCCGGCGAGCAGGACGGCGTGCACTACCATTACGTCACCAAGGAGCAATTCCAGGCCCTGATTGCCGAGGACAAGTTTGTCGAGCAGTAAGTGCCACTCAAGCTTACTTGAGATAGAGCCATGATGCAGATATGCATACGTACTGGCGCATTCACAAATGGCTTTCGCTAACCCACACTCCCTTGAATCTCTGCTTCAACAGCGCCCAGTTCGGCAGCAACAACTACGGCACCAGCAAGGCTACCATCGAGGAGCAGACGGCCAAGGGCAAGGTTGTGGTGCTCGACATTGAGATGGAGGGTGTCAAGCAGGTCAAGAAGTCCAGCATATCAGCCCGCTACGTTTTCATCTCCCCGCCGTCGGAGGAGGAGCTCGAGAAGCGCCTGCGGGGTCGCGGAACCGAGAACGAGGACAGCGTCAACCAGCGCCTGAACCGCGCCAAGGAGGAGCTCGCCTGGTCCAAGACGGAAAAGTTTGACAAGGTCCTCGTCAACGACGACCTGGAGAAGACGTTCAAAGAACTCGACGAGTTTGTTTACGAAATGCCGGCACAGTAGACAGGAGGGGGCCGCATCAGATCAGATGGGTATACTTTTTTTGCGGTAGACTCTTTTCGGCTAGACAAAAGCACAAGAAGCGACCTTCCCACGCGATATGGGTGTCTATGATTGCCCTCGTGCCCTCGTGCCGTTGTGTTTATCGTATCTCATCCACTGTGCAGTGGAAAGCGCCAATCGGTAGTCCAACATGCGACCCTCGGTATCGTGGTCTAGCCTTATAGGGCACATGCCGCGTATCGTCCAATCTACGTTGCATGCCCACCTACGGAATACTACTTACTCCCTTTATAGTACGAAGGTTGAAGGGGTAAGTTCCAGCACCCTGGCACAGTACAAACCTCATGGAATTGCCCTAACGGCATATGAATTTTTGGGCTAAAAAGGATTACAAAAACTGTGCCACGCTCACAGAACTTACCCATCTAATCTCTGTATGTTTATTCAAGCAACATCGGCCAAAATTTCCTAGCCATTACACTACCTAATAGCAAACTGGAGTTTCTCTCTTGTTATTTTTGGAGATCTCACACGATACGACGACCTCGGCTGCACGCTGGATCAGCAGGGTTTCAAACGCTATATATTCATTAGGATAGTATCATGTTCATGTATGCCTCCTCGGTTTACAGTAGTACAGCAGAACTCCTTGTCTACCCCGCTAAATGGCGACGCATATTTCCCTCTAAACATAAGATTACCCGGCACGAACGCCTCCAACACCAAACGCCTGATACCAAGCCAAGTCGTCACCTACCCAATTCGTGTTTGCCGCAAATACAGTTCTGCCGATATCTAACGTTTTCAGCCATCCATCTTCACATCCCCATCCTTGCTACTATCAAGATGCTTGAGAAGATAGCTGCGTTTGAAGTACTCGTTGGGATGTACGATGGTTTCGAGCTGTGCCACGGTCATGATGCCCTCGTCCTTGGCGCGTCTGATCTCGTTCTTGTGAACATATTCAAAGACCCTTGAACAGAGATTAGCAACTGCTAGGAACTAAACACATAAGCATGAGACAAACAAGAAGAAAAAACATACCTGTTGCAAGCCAGATGGAACTTTTGCTTCTCTTTGTCTTCTCTTACCCCGTTCAGAACCGAACGGTCGTTGATGCCGACCTGCTGCAGCAGCGCCGTCAGGTTCTCCAAGTTGAAGTGGCGGTACGGGCACCCATGCGCCTCACCGGGACCAGGCGGGTGTTCTGTCAAGATCTTCTGACAGCTGAACGGACTGTAACCGCGGCCTCTCCTGTTGGCGTCGCCGCCCACATCGCCATAGACGTGCCTGACGTTGTACCTGTACTCCTTGTTGAAGGTATCATCGGTAATCTTGTTGAAGGAAGAGCGCCAGAACACCAAACACTCCTCGAGCGAAAGGCCGATACCCTTCAGGAAAAGAGAGTATTGTAGACGGCCAAAGTGCTTGAGGTGAGAGTCACGACGCAGCGAGCGATGCAGGTGTTGCATGCAAAGCGGAAAATGCTCCGAGGAGAGTTTGTCCACGTTTGCTGCTGTCAGTTCAGACCCCGGTGCGGCCTGGTCGTCGCCGCCGCTGCCGTATGATGCGTCTGGAGTGATGAAGTTCTTGGAGAGGTGGTTGAGGATCGGAGTCAGGCGGTCGTCTTCGTCGAGTCGGGGAAGGGCGCGAGCAGTAAGCTATATAGGGGCGAGAAATGTTAGTCCTCGTCACAATGGAAAAAAAAAAACGTGTTTCAGACTTCATAGCTCGTGGATCCGTACCTCGAGTGCCTTTTCCAATCGCGAAGTAAACTCGGTGACTACCATGCTTGTCTGCTCCTTGGCAGGCACGTAAGCCTTGCCCGCCTTCAGCAGCACCCTTCTGCCTTCCACAAGGTCCGGTACCCTTTCCCAGTCAACTTTGCACCACATCTCATCGTCTCCGGCAGATTCCTTCTTCCATCCTGCAACTGCGGCGAGTTCTGCCGATAGACTTCTCCTCTCATCCTCCGGAACGGGCTCCCATTCCAGGCCGTCTAGAGAAGCGATGAAAGCAGCGCGCTCTCGGCTGTCGTCTGCCGCCAGCCGCATCCGAAAGAGCATAGTCTCGACCCTGACAAACCTCCTCCTCAAGTCCTCAGTGGAGCAGAAAGCCAGCCGCAGGATAAAGTGTCCATAGTGGTCCTTCTGCCTCTGTGCGTGCAGCTGCGTGGAGGCGGAGCTGTTGGCCTCAAGCGGGAGGTACTTGTCGAGCAGGGGCTTCATGTGCAGTGCCGTCTCCTGCGACGTCTTGTTGCGGAAGCTGCAGGCCTCGAGCTCGGCGAGGATGCGAAGTCGGTCGATGGCCCATTGTTCAAACTGCTCCAGCGTAATGTCGGCCGTCGGGGGGATGGCGTAAAAGTTCATACGGTGAGGGTAATCGGTCGCCTTGTAGGCCGGGTCGGCGAACTGCTTCTTTCGATGATCGGTGACATTGCGCCGTTTGGCGTCTGGTCGACTAAAGTCCTGCCTGAGCATGGCGATTTTTATGGAGTAGTGGAGAGTCGAAGTCTATTGGTACGGTATTAAGTACTGTTAGGCCTTGATGTTGATTTCTTGTGATCCCGGTATGCATGAAAAGAGTTAACTCATCAAACATTGATGATATTGTGGTCTGCCCAGAATACCTACCTAGGTATCTAGCGTCGGTGTACTCGAATTTACTACTCTACGCGCTTTGCCCAAAAAAACACGCGAGTCGACGCGCTCTGGGCGGGGTGGGAAAAAAGTGGCGCGTCAGCTCAAGTGGTAATTGGGAATGGGCGTGGTAACTCCCGTCTGCAAGCTCCTTGGTGCCACCACACCCCTCTCTGTCAGAATAGACTAAAAGCAAGCGGGGCGGCCTCTAAATTGAGCTTAACCTCGCCAACGGATGATGGACAGGACTGACTGCCCGATCCCGCCTTTTCTGCCAGATCTGAAAGCACTAGTGTCGATAGCATAGCCGACGCTAAGCCGTCGCCTTTTTGGGAAATGCATTTACCCTCATGCCACCAGTCAAGCAGTTCACCCTTCAACTGAAAAAAAGTAACAAGTGAGTACGCTATCAAGGCATGTGGGCAGCTAGCTCAACCGGGGAATCCCTACTTGCAATAAAAGCTGGCAGGTAATTATCAGGCGTATGTAGCAATGTACGGTATTCAAAATTGAAGGGACTCGAATAATTCGGCTGGCAAGTGGAGTTTAAGTGGTTGAGCGCACGTGATGGCCGTATGAGGAAGTGCGCCCGGTTTCGTGCATGGGGAACGAATCTATTCAAGTCCCACTTTGACTTGAGACCCTAGAAATCATTCTTGGTGAAGGTCCAATCAATCTCAAAATCGGCCCTCGGCCACCCATTTGCAAGGTGTGCTAGGTGTATTGATACCTACATATGTGTGCCATCAAGCCTAGCCTAGTCTCGGCTGGTCTGGTTCACCGGCTGCGCTAGGATGAAAGGGGGGGTTGTGTTCCCTCCTTTTTCCAAACTCAACAGAACCACGCCGTCGGTACTTGACCTGGTTGACCTGACCTAACCGGGCCTGACCTGACTTGTCCTGTCCCCGATCCGACGCACCGCCCTCTACCTAGGCCCAATCTAGTCTCAGTTTGCCTCCTCGTCACAACCCGGACTTTTACTTCTTTCTTTCCATCCGCAACCTTCTTCTGCACGCTCCTTGTCACTCATTGTAAAGGGGCATCGCCCAACCCAAACCAAACCCACCAATCGTTGGTTCATCCATCGGTCGGCCCTTTTTAATACTTACTTTGGTTGCAGGCCTTTTTTTTTCTTGCTGCACAATTATCCGGCCAAGATACAATCAAACATGAAAGCAGCATCATTACATACATTGCAGCTAGTGTTATTGGTGGCAAAGGATTGAAGATCCCAATTCGTCTCCATGCAAGTGAACCACGGACGGCCGGCATTTTATCACTCACTCGCAGACATGACGATGATGCCCACCGTCGCAGCCATGGCCAAGGCTGGGATGCCGTCTGCACGTGCATCGCATGCGCCAATGCATGCTGATGAGAGGACCGAACATGGCACCTCACAGCTGAATGCACTGGCCACGCCTCAGCCTTGGCCTGCCCAGGATCGGTGGGCTGAGCTCCGGCCTATAATCACCAGGTTGTACAGAGAGGAGAATAAGACTTTGAAGGATACTATGGAAATAATGGAGCGGGAGCATAATTTTTCTGCCACGTACGAAAATAGCCCCTCTCCCATCCCGCTCCATATCATCATGTCGTTTCTGGTTAATTTATTAACATTCCCGCGCTGCCTAGGGCGAGGATGTACAAGACTCGCATTAAGAACTGGGGTCTGGATAAAAAATTCAAGGCAAAGGAGGTTCTTGTCATGCTCCAAGCGCAAAAAGAGCGCGAGGGTGACAACAAGGAGACTGAGTTTGTTGTCCGCGGCCACAAGGTCGACCAGCGTCGCATGAAACGCTACCTGCAACGCAACAAAATCGTTCTAGATCGTTTCAAGGAAGGCGATCTGCCGCCAGACGACACCGCTACTACGTTCAAATCGTCGGTCTCTGGGTCGCCGGAAGGCGGCTCGCCAGAATCCCGCTGCAGTGCTGGCAGCACTGGTACCGGTCGGCTTTCTAGGGGACGTCGAAGTTCGGGTGTCGTCGTCCACGTACGCACACCTTCGCCGGAACCAGTGAGCAGCTCATGGCAGTGCGTCACAACCGAGCCGAACTCGCCAAGGCCCACGCTCGGCCTCCCAGGTCCAGTCATAGATGCAGAGAGGCTCCTTCACGCAGTGAGGTCATATATTGGGGGCTCATTCGCAGCTGGTACATGGTTCTATGATGCCTTTGGACGCATCCAGAGTCGCAAGGGAGGCACCGCCGATTCTCTTTTGCTTGACACCTGGACCAGACTCGAGGTTGTGGCCTCGGGCATGGCTACGAAGCAAGACGTAAAGGTCTTTGGTACATTAAATCCAGCCTTTGAGTCTCTGCAAGAAATTGTACGAGAGGAGGCGCCACTTCTCATCAGTCGTATGCTACGGCTGTCACGCAAGCTCGAACTGCTCCAAAACCGCCAACTCTGGGCCGTCCTGGTTGAATACATTGGCGAGCAGACGTTGCGAATCCTGGGCCCAACTCACGTTATGAACATCATATGGCAGCAATTTCGCGACATGGATGTGGGGACCGACGAAGAAGTTCTTGACCGCGCCTTCATGCTCATTGTTGCCGAGTTCGATAGATGCTGCCCATCCGCGACCAACTTTGGCGTGCTGGAAGCTTACCGGGATCACTTCGACACCGTGTCGTCTCCCTCTCGCCGTCGAAATTTGGAGGCCCAGGAGCTGAGTCTTCGTCAGACACTGGCACTCATGCCAGCGCACGCAAGTGGTACACCTCCGTTGCAGGGCTTGCTCCTGCGGATGCGCATAACCTCATCTCTTGTCGCTTGTGAGAGGGGCGAATATGCACGCGCCGAGAACATCCTGTTTGACACCTCATTCGCTGAATTTGGATGCCTCGGTCCTTGGGCCGTTGCTTCGCAGCATGCAGCCCTCGGTCATATACTGGTCGCCAAGAAAGACTGGGTTCGAGCAGAGCAGGCATTTCTTGCTGCCGTCGCACAGGTCGAGGGCGCTACAGGCTATCAGAACGAGAGCTGCTGTGAACGTATGCTGGCAAACCTCGAGCGCCTCTACACATCCACGGGGCGATATCATGACGCCACTGAAATGCGCGACCGTAGATTGAGGAGGCTGCTACAGCAGTCACAACAGCTCGGTCTGTCGCGGGGGCTACCCTTCCAGGCGGAGCGTGAAATAATGCCATATTCAGTGGTGAAGTTGGAATCTCTAGACAAGTTATGACTGCGTAAAGTCTGGGATTTCTAGCTTCCCTCTTCGCCTAGGCGGCGCGATACACCTACCTATACACGCATGTGCTGCTGATAGCTGTACAAGAAGCACCAGTATCAGTGCCGGGCGGCATAGGAGGTCAAGTATCTCTGAATGGGCAAACACAGAGTACAAGTCGATTCGGGCCTCTTTTTCTCCCCTCTGCGGGATGACCGGGTCCTTTGAAGAGAGTAAACGGGACGTGCGTTGGCTCCCAGTGGTTCCTCTACCGAGAAAGCGGCAGAGACACCCATCGATACCTGCTGAGCGTAATAAGCGAGCGCGTTCCCAACAACTCACCGAGAACTGCCAGGCACTTGACTCATGGCATGTCCCAATGGTCAAGGTCGGGACAGGGCACAGTGGATTGGGTTTCATAAGGGCACATATTTGGCTCAGTTCCGTCTGTGCTCAAGCGACATTCTGTCCACATAATTGGTCTATGGTCAAACTGCCGCAATGCTTGTAGGTATGGATAGACCAAATAACAGAATCGCCTCGTCCGATGAGCTAGTTAGCGATTGGGCTGCTAATGCTCCGGTTGCTCATTACTGGCTCAAGATAAACAATGGCATTTGTGGATTGAAGCCATGGTCTTTATAAGCCAAGAACGGTTCCCCGCATTTGGAAGGGTCGTGGTGACGCCGTGACGCGAGGTCCATATACGGTACGGTAATATCTAGTGTGCTTATGTGGGAATTTATGCCACATTTACGCATGGTTTGCCTCTTTGGGGAGGTATTTGTACGGGAGCAGGACCTGTAAAGAACCCACCAATGCGTACTCGGTACAGCAGCAGTTCAAATAGAGCAACGAAAACAATAAAATCAAAACCCCAGCGTTATACCGCCAACTAGGCCTTTTTTGGGTTTGGTTCCAAAGGTCCTTCGCCAATCAGTCATGTTTGATTGAGTTTCTTCCCCCATTGAAAAGGCGGCCCGCTGCTGACAGAAGTCATAAAAGACGATTATCCTGGATTTTGCCCGATTTTCCCATGCAGCCAGGGGGTTAAGGATGGAGGCTTGCAGCACAGGCAATTTTGGGAAGTACGATTTCAAGATTGAGGATGCATCCATTGGGTGATTTTGAAGAGAAACACGACATTTCTTTGCTGTAACGAAGGAAGCATGTAGCGGCAACCTGCGGTCCATTCGGTGGGACCCAATATCCCGGGGCTTTGTTGGCTTGCATGGTCTCTCTATTTGTGGGCTGAAAAGGGACCATGCATTGAAATAGCCGAGTGTTGTTGGGTTATTGTTAGTGGTTGATAGGTTTTTAGTCGGGAGGTACAATTGTGAATTACCTACCTAGGTACCTACCTACCTAAACTATCCTCCCTACCTGACCTGCACATATTCTTTACCATCCGACCGAGGTGTTTGACTCAGTACAGTTCAGTATCTAATACAGTTCTGTTTTGTATACACACCTGTGTTATCTATCCGTGATGCTTGAATCGAATTGAATGATATTCCCCCCCAAAAAAGGTAGCTAGGTGCGTTTGTTTACCCGATGTGTCCAGTAGCCTTACCGCCTTGCCAAGCCTTACCTACTACCCCCGGGACAGTAGCGTAGTTTGGATTACCAGGTTAGCTTTATAGCCTATCCCCGGCTTTGGATTGGACGGGGAGAATACAACCATACCTGGTAGCCAACAGTTCAATGTTGCATACCAAGGTAAGGCAATATTCCGGAAGTGAAGTGTGTCCACCTCCCCGCTGCAC
GTCACAAACAGCTACGTAGCTTACGTAGTTTTCTCCATCTTGACGGACACACACAAATACCGGTAAATGTGAATCATGTGTTGCGCAAATCAAGCAGAGG
TTAACAGTATCAGAGGAAATGCTTGAGTCCATTATTATCGCTTTAAACCATCACCCGGTAAGCCTCTCTAGAGATGTATCGTCATCTCCATCAGCTTACA
CACCATTTTACACCGCAGACTATCTGCTGCCGAGATCCTATACTGCCTCTTTCTGTCAGGTTACGCGGCGATAGTCACTGCACAGCCCTTGCAGTGACTA
ATGACGCCTGCCTCCCATTCGCTGCGGCCTGAGTACCTCCTAAGAGTCGCCTCCGCCACAGAGAACCCGAGCTGAACGAGGTACCGTAACCCCCCCCCCC
CCCCCCCCGCCGCCGCAGGGATTACCTGCCTGTAGGCCGACGTTTTTGGAAGGTCTGACCACGGACCACAGCTGACGGGATGGCAGATGGCATATTGAAA
AGAAAAGAAGAACAGAAAGACCACCTCCGGCTCGGAAGGAGGGGTACAGAATGTGACGGCGGGGTTGAGGTTGAGGTTGGCGGAAACGGTTGGTCCAGAC
TTTTGGGCCCCGCGCCCAGAACGCCCCAGCTGAGCCAGACCCGGCTGTCGTCATTGGTTCGTGACGATCAGCAAGGAAAGGCTCTGTCACTCTAATTCCC
ACTCTTTACTCTCTTATCCTTGGGACACTATTATTATTTGATGCTTTTTTTCGGTAGGTAAAAGTACGGCCGTCTTGTCATATGTTAATATTTCCCTATT
TTATAGCCGATCTTCTTGCAGATCGCTCGACTAAAGCACCCCTTTACTCCTTTTTCATACTGTAGCAAAGGCCGCCCTTTTGAGAGACTTTTTCTACGCT
CATCGAGAGAGCCTAGCGTTCAGCCAACTCGATGTACCCCTGGGTGACCAAAGCGGGATGGTATGTGCTGTAGAGCCCCGCATTCTCTTTTCTTCCGTGA
TCCCTACCTTATCCAAGACACATTACGTAGCGTACTACAGTAACTTGCCCGAGCTTACTGGTAGTCCTTGGGACCTGCTGCTTGAGATTATGGTCTGCGG
ATAGTATTTTTGCTTGCAAGTAGCCTAGAGCTAGCTATCGTACTTCAGGGCTAAGGCATATCGAAATCCTCGACATAGGTAATGGAACTGGAGCTGAAGA
GAAGCACGCACAGTGGAAAGACGGATATGACCCCTCAAAAGCTTGGGACTGCGAAGAAAAGAAAAAAAGAAAAGTATTGACGCAAGTCACTCGGGTCCAG
CGTTTTCGACGATGCGTAGATCCAGGCTGCCCCCGCAGGTCATGGGCTTGACTGAGAATAATACCGACGCTTCCCAAAAAGCATCACCAACCTTGCAAGA
TTTCTGGGTTTGCTTAGTTGATTGGTAGCCAGGTTTAGGGCCTCCCACATGGTCACGGGAGCCAAGCTAGGTGATCAATCAGAGAGCCGGTCCCACGCGG
TGGATTGAAGCTTGGCACTGGTACCTTGAACCGGCGGGTGCGCATTGCAGAACCGGATGGGGTTTGACGAGGGATATGACCATGCTCTCCTTGGTCTCAG
GGATGCGCATGGAGATGCCTTGGAAAAAAGGGCAAATGATAGTACGTTGTAAGTTGCTGGATTATCTTGTGAGGTGCGAGGTAGCAAGTGACAAGCTTAG
ATTCCGACAAAACCTAACCGAACAAACCCGTATGCGACCCATGGTTATGCGCAGTTTAACTTCTGTCACTGAATCTATTATACCGCAAACTTTCGGGGTG
GGTTTGCGTTGCGACGACACGAGACTGCGGGTGGCGTTGCCAACAGCGGGGCGGCGAACGGGGTCCGTCCTGGCTTGCGAGCGGATGAACAGCTGAATTG
GCCAACTGTACAGGCTGCGTTGCTGTGTGAACTACATAGCCAGCCTGAAGATGTTTTCTTTTGACAATTGAACATAGCTGCGTAGTAAGGCACAAGGTAG
TGCAAACTCAACAGTAGCGGTCAAAGTTGCCCAGGCAATTCGCCCAATTGACCCGTTCGTCAACGGCACTCTGCCTGGTACAGTAAAGCTGATCGATCTG
GTCCCCCGGCGGGGGAACAACGGAGATCTACACAGAGCTCCTACCGATGTGGGCCATGATTCCGTGCGAGGAAAAAGCATGTGGGCAAGGGTAGCTCCTG
CTGATGCTCCGATGGCCCTGACCATGGGAGATAGAGCTTGCAAAAGCTGTTGCTGGTCTGCTGCAAGGCCTGCAAAGAATGGGCCCGGGGACTTGGGGGA
TGATGCGAGACTTTGAAGGTTAAGGTCATACTAAGTGTTCACCCGAAGGCGTATACACCCTGGATCGGCTAATCGCTATTTCGTAAATCCATGCGGTGCG
TGTGCGACCATGAGAAAAACAATCAAAGGGTTTTGATTTCGTGGGGTGACAGGAAACCCGATCTTTACTGTAAGACCGACCGATTTTCGCGTCCTTTTGC
TGGTTGCGTGACCCCTAGAGATCGAAGGGGAAGACCAGACCATAGGTACAGTATATCATAAGAACAAGCTTGCAAAACAAGTCAGACGTCATGTTATTAT
CCCCGTTAGTGCCAAGAATGGTGGATCTGCCTACTACAGTGTCCATGGCTCACAGGTCAAATCTGGAGCTCGTTCCAGTCATCACACACAACCCGTTAGG
AGTTAGTTGCAGAAACCCATCCCGAAGACGCCGCACAAATCCACAATCATCCTTCGCAACAAGCGACGCATCCATTGGGGTCCCTCTAAACCCATTTGGC
GATACATTTTGTGTACTGAGTAAGGTATCATGGCTGTGGACTCGAAGGGCTCGTTTAACACATGGCCGTCACCGCTATTGTCGTTGCCAGGACATCGTTG
CTCCGCAGGACCCATTAACACTTGGCTGACTTATCACGTCAGTACTGTACGGTACTTTCTAACTTTGTAAAAGAAAAGGAGCATTGTCGGCCTTGTGGGA
AACACTAACTCGAATGTTATCATGGCACCAGATGTCAAACCCGTCGGTTTACCATGTCAAACTTTTAGCAGGCGGTCGGCAATATTCAACACCCCGATTG
AGCATGAACGGTTTTACGAATCATTCCTGAACCCTTGCAGGCTTAAGTGATTCAACTTGTGTAATCCGTGACGGGCGTGAAGGGGCGCTTGGTAATACGG
ACATGACCGACACAAAGTATCATTCGGCCTTTCTGATGTGCAAGAACCGCCACTATCGACAAGCCAACAAGCCCTCAAGGGACGGGTACAGCCATGGCGT
CTATGCTAAATAGATACTTGATTGTCCTTGAAAATCCATCTCCGTGACAGTCTGATGAAGATCTCTTGCTATCTACCTACCCCTGATAATCAGAGACACT
AGAATTAAAACCTGTACCTTTTCATCCTTGCCCCTTTGTCCCGTCCATTATAACCCGCCTCAACGGCCCCGGGGCGTTTTGTAACTGACGTTTTGGCGTC
TCGGCCTAGACGCAATCCGGTCAAGGACAAGAGCCCCCGCGCGAGGCTGTGATGGTCTGTGGCGGCGCCCGTCGATATTTGCGAAACGTGCCCTGAGCAG
GAGACCACACTTCAACGCCACACACGCGTGCAAATCTCAACGAGGCCAGGCACGCGAGCCTTCCTAGCTTGTATGGTGTGGTTCGCCGCCATCTTTTTTT
TGGGGGGTTTATTCACTCTGTCAGGGCAAAGGCCAGCTACGGCGGCGCTGTGCCGTGTCATCACATCCTCTCTGCCCACGGTTTGGAGGGGTTGGGAATC
AGTTGCACCGAGAGGTCTGCCTTGCACGAGCCAGTCGTGGGTCGTACCCGATCTGTAAGGGAATAAGGCTCCTGTCGGAGACGACCTATTTGCCGACCCA
CGACGAAAACATCGCCGAAAGGCATCTCACTCTGTCGCCAACCTGCTTACGGGACACTCCCCTCCCAAAAGTTCATTTTATCACCTGCCTGCTCCTAAAT
CCTGGGGAATCCGACGCTTTTCCAATTTAGCAGCAACAAAGGTATGAATTCCATACCTTTCTGTTCTTAACTTCACTGCCTTGCTGTTTCCCGTACATCA
TCGCCCAGCGTGGGGTGCGAAAGCTCCTTCTAGCAAAAATTGGTGGGGCTGCAGTCAAGCGACTGGGATTTATTGATCTCCATGTCAAGAGGTCCTCTGG
GCAAGACCGCGAGGCATGTGTCGCACGGTGTGAATCCCACCCGATCCACTTTTTGCTTTCCTGCACAATCGTCTGGCTACAAATAATCAACTACTGGGGT
GGCCAAGGGGCCCGCCCCATGTTGTCTCCGCTGTTAGCGTCATCAACGGACCATTCAAAGGCCCTAGGATTGACCCTCGCCTGGGATTTCAGAGACTCCA
GTTTTTTGCTTCGCACGCCTGCCGTTGTGTGGGCGCCCGTCAAAGAGGAAGTAGAAGCGGGCGAACGCAACTCAAGCACGGCGCAGCCAACCACGAGCAA
GGGCCCCGTCTAACTTGGGCGGCGGCCAGTCGACACCGCAACGTCTCTTAGAAAGCCTCATCCTCGCACCTTCGTCCCGACCAGGTTGCCTGACTTTCAC
TTGGGACGGTCGCTCGAGCTTCGTCTCTTGGGCACCACTTTGTGCATGCATGCATGACAGATGCCAACAACCTCGTTGTTCTTTGTTTTGTTTTATTCTA
CTATCACGCTTCTCTTGATTTTTTCTCACCACGATAAAGCATCCGATTCTTGCTTGCTACAACGAGCTGTCTGATTACCTACCTTCCCTACCTCGGCCTC
TTCTTACCTTTGAATCGTACCATACATTCTCATACATTCATATCCATCTTATGAATCTTCACATGTACATTTAATCCTCGCCTCCTCTGACCGACCATTC
ATTCCCTTCTATACCCTAGCTTGCAACCAACCGGTGCCGCCCCTTTTCTTCTTCTTGCCACACTGGAATGCAACACGGCCAATAGCTACTTGTACAACCT
CAAACCACCCAAACCCACCTTATACCAAGCCAGCCTACCGCCTCAAAACGCCACTGTGGGCCCTTTCTCTCACGTCTACCGTATAGACCGAAATCAGCAA
TACGCTCCCCTGCGACTTCTCCAATTTGCTACCACTTCGAGAGAGCTGTCGTGAGAGCTCCTCTCCCTGGTTCACCCCCAGGAGCTTAACAGTTGAATAT
TGCTTCCCTCACGCTGGCGTCGACTGAAGCATCAGACGCAACTCCGTCCAGTCGCATCGTAGCGCATACTCGCAAACAGTTTTCTCTCCAACATGTTAGA
ACCGTTACCTCCGGATCCGTACAAGGCGCTCGACATCCCTGCCGATGCCCAGTTCGATGTCATCAAGAAGAGGTATAGGGAGCTTGTGCTGAAATGCCAC
CCAGACAAGTGCCCAGGGGCGGATAAGGCGGCTGCGACCGACAGGTTTGCGGCCGTTCAGAACGCATGGGAGATTCTGGGAGACGCGACCAAGAGGCAAG
ACTACCACAAACTCGTCAAACAACACAAGCTGGCGGAAGAGCTTGCGAGGAGTACTCGCCAGGCACCAGTACCTTCAGCCAGCCGTGGGCCGTCATCGAG
CGGATACTACGGAACAAGCACATATCACTCATCACCCCAGACACCTTACGGATTCTCCAGGAGCGGCTCCAGCAAGACTCGCTTTGAATATGAATCCCGC
CACGCATCAGCACCTTCATTCTACGAGGCAGATCCACGGAGCGGCCCGCATGCTTCGAGGGAACCCCGAAGACCCAGCTCCTGGGACGAAGACCGCTCAC
GCGAGACAGATCGATCCGCTCGCGATAGGGATAGGGAAAGGGAACGCGACAGGGAACGGGATCGTGGTAGGGGAAGCCCACCAAATCGTGACCGCGAAAG
AGAGCGCGAAGAACGCGATCGCGAAAGGACACGGGGCATAAAGCGGGATGAAGACGAGCGCCAACGAAAGTTGAGAAGCAAGGAGGCGAAACGTGAAGAG
AAGGAACGAGCCAAGGAGAACGAGAAGGCGGCCAGGAAGGAAGAGGCACGTATCCAAAAAGCCAAGGAAGAAGAGAGGCTGAGGAAGAAGGCGGAGGCAA
AGCGAAAGGAAAAGGAAAGGGTAAAGCAGGAAAGGGATGACGAAGAGAGGCGCGCCGGACGAAAGCAGAAGATGGAGATGGAAGCGGAGATCAATATACC
ACTAAGGGAAAAGATGAAGAAGGCTCCTGTCGAAGACGAAGGTCGCTCAAAAAAGACAACCGTAACGGAGGATATCCGCAGCTTCCCCGAAGACTTTCCC
AAGAGCGAACGGGAACACGAGAGACACAGCGAGAGGTCGAGGGACCGTGACAGCGGTCGCACAAAGGAGCAGCGGCGGTCATCGCGTAGCGAGTCTAAAC
GGCAGAGCTCTCATCCTCGCCGGACCACCTATTTCGAGGATGCACCGCCTACTTCGTCTCGATCCTTGGAGGATTCCGCCTTGACCAAGACCCAGAACCT
GCCGCCCAAGTCAAAGACCCAACTTGAAGCGGCTTTATATCGCATCTCTGCAAACGGCGGGTTGCCCACACAGTCACGCCCGCACGTCTCTTATGCAGAT
CATGAGATACATGACTCTGCAGACTATAATCATCGTGCCCCAAAGCTTCACAGATCAGCTACCGACCATATTACCGGAGACTTTGGCTCTCGTCCCCCAA
AACTTAGCCGATCTGCCACTGAGAAGGTCTCATCTCCGCGGCGATCCTATGAGCCCGACTATGACGGATATGGAGGCACTTCTCCCAGTCGCTATTACGA
TATCCAGGGCACTCCATTTGGCCGTGCAAAGTTTGGCAACGTTGACACGCGGAATCCGACCACTTCCAGCTGGGGAGGGCATGTTGCAACATCTCAATGG
GAAACCCCTCCTGAGTATTCATCATACATTCCGGAAAGTAGGCCGGCGAGATATCGCACCGCGGCGGCGTCTTACGACTATTGAGGCAACCAACCAATGT
CGTATGGAGTTGACTTCTGCAGCCCGTACGTCGAGTGAGCATTAGCAAGGCTTTGCTTAGTGTGTGGCCGTGTCAAGGATCTGAAGGCGGTCTGTTGGTT
TGGAAGCTGTCTCAACGCGTGTTCTAACTGGCTGCGGAAGTGGTCGTGGGCAGTAGTATCCTGGCCAGTGTTTGTGGTGCATATATTCGTGGCGGTAGCC
TATTGGATATTTTGTTTTTCCATCGTGATTTGGATCTGGAGTATCATAGTGAGTGGGCATTTTCGGTATGTTTGCCTGGGTGGCACTGTTTGTTTTCTGC
GTGTACAACTGGTCTCTTTTTTCTTCCTCCTCTTGGTGTTGCAGTCATAGCAACGCTAGACACTATCCGGTTTGATTTAGATATCATATCCGTAAATCAT
GATCCACCCGTCTGAATGGGGGTATCAGCAAACTTACACATGGCGCAATGTGTGATTTCATGTGACCCGGGCTTATGCGGTATTATTTTCGATCGAGATA
TACTCGAGTAAACACCCTTGCGGATAGGGAAAACTCGGGAGTCTGGAGCTTGTGCACATGACGGGTGAGAAGCTAGCAAGGTTAGGCAGGTGAACGGGAA
GAAGAAGAGCAGCCAGACCGCCAGTCCTCGCTCGGTATATAAGAAAATTCCCCTACCACACTTGCGCCACTGACGTGAGTCCCTGTAAACCTGCCGCTGC
CTTGATTTTTGGATCTTATTTTGTTCTATAAGGACCCTTTTCACTCTGGATGTCTGCCGCTCTGTGAAAGCCAATCCCGGTTTTTGGTTCTCGGGGATGA
TCTCGGCCTGACGTATCTTTCCATCCAACAGCGAGGCTTTTTGTTGTCCAAGGCACAGCGAGAGGCAGGTGGCGACCTGGCACTCAGGAGCCGACCGACC
TTGTTTTTTGGAGGGTGGGGTTCGGGACTCGTTGGGGGTTTCCAGGTGCGCAAACAATAACGGTTTGGCTATCAGAGTTGGTGTTGACCAAGACCCTGGA
TTTGTCGGACAGGATAAGAGCAAAATGTAATTGATTTTGGAAGGTAAGGATTAGACCCAAGTTGTGAAGTTAGGGGTCAACGAGCAGGGGACGACGTGTA
CCGCATCTAGCCAACTGATTTCTTCTTCTACTTCTTCTACTTCTTGATGCTTTGTCTTGCTCTTTTGCTTGTCGCAAACCGACTCTCCGCAATAAATAAC
TCTGACACTTTAACCGTCGGTGCGGGTACCTACCCTAGCTGCGTTCCAATACCAGGCCAAACAGCGACGCTCGAAGAGCCGGTGTGGTGGAATTCCGATA
TAGGTCTAGATACCCTAGCCATGGAAAAGTCGCAGAATACATGTGCAGCTTTGTTTAAATATCGGGAGGGTTACGGAATACTACTATCCGTATAGTAATG
CGCGTTGCTTATGCGTAGATGACTACCTACATCAGTGGATTGCCTAGCCTCATCGTGATGCAGTGTGGTCGATAGACGAAAAGTGGGCATGTATTGGGAT
GAGCTAGCACGCACACAAAGATTGAAATTATTTTTACAGAATGGTGAATCTTGGCTTGCTGCCCCGACAGCCACAGTACCAGCGAGCTTTGCCACTTCGG
AAAAAGAAAAGCAACAAACCAGAACTTAAAATGCGCCGGCAACCTTTGCGAACTTCAAGGCTGAAAAGTAAAAGGGAGTTTGAACTTGTCGATAAAAGGA
AAAAAAGATACGATCTCGGATACGGGGAATCGAACCCCGGGCACGACGGATCCTGTTGAGGATTGAGAGCGTCGTATGTTAGCCACTACACCATATCCGA
TGTGGAACTTGTTGAACATATGAGAATAAGTTAGCCTTATCAATAGTTAGCAATCTGGAGATGCCAACGCCCGCGATACTCTCAACATTTTGGGTGGCAT
AGTGAGATGGACGATGGGTTCAAAGAGTCTACCGGATATTATGGCTCGGTGCAAGTCTTTTCCCCAAGTATCCGGATGCGGGTTAAAGAGCGATACCAGA
GACTTACGTGTTTGTCTAGTTCTAGTGTCGAAGTTCGGGTTTGTTGGTATCTCTCTCCTCTGCATATCTGTCTTTAGTAGTGTCACTATGGATGCAATCG
CAAGATAACAATAATACCCCCATTCGATGCTACGCTCTTGGAATAGTTTCAAGACGAATTGTTGTTTGCAGGAAACCACAGTCTCTTGCACTTCGTAGCC
AAGTCTGCAAGCTGTTGAACACCGAGTTTTTAATGCCTTTGGTCTACTGCCAGCTAAAGCTATCGCCGGGAAAATTTCCACTGTGGCATGTCGCCTCCTT
TTATGCTCGTATCGGAGAGCATTGCCCAGAAGTAGATTGTTCAAGCTTCCATGCCATCTAGCCATGCAGTTTCGACTTTCTCAGCGAAAGTTGTTTGGAT
GGATACATATTCATAACGCTTGCTTGTTATGTTATTTATTATACAACTATTTAACAATGATTCACCTGCTCACTCAGCACAGACAAAACGTGGGCTCCTG
ATACTAGACCTAGGTAGGCTTGAAGCTGATCTAGAGAAGAGAAGTGGGTGCCTCTTGATGAAACTACCTACAGTACAAATGAAACCTCCCAGGGGTATTC
GTAGGCTGTATCCTAACTCCAACAGAAAAAAAAGTACATTGATGAAAAGTGACAAGCGGTGTGTTCTTGCCGTAACATGAGAACTAGAACTACAGGAGGC
AATTCTGGTCAATATGTCAAGTTGTTCGCAGCAACAGCGAAAAACAAGTTCAATCGCTATATCAGCACATAGAGGGAGCACATCTATCATGGAAAAAATA
TATCTTAGCATCCCATTTGATTGTCATCATCTTTGCGATTGGGAAAATGGAAACTCAC
CATGCTAAGGCCCATGATCATTGAGCACCAGAAGAACACATT
GTTGGCTGTGTGCTTTCCTCTGATCCACTTTGTACGCTGCAGGGCAAAGATGGGCAGCTGCAACATCTGGCACACCAAACCGTAACCCCTCAGCTTCTTT
GTGATGCAAGCCATAACGATCTCGTGGCCGATGGCGCTGATCAAAAAGGTGATGACAGTCGCATATGGCTTGCCGATGTGCGGCCTGCTTGCGCCGTAGA
CGTGCCTCCTGAGGAAGGCATGGACGGGCACGTTCCACTCACGTGAGAACTCCATCCAGTCGGTGCTGTTCCACCAGTCGGCGAAGAAGCGTCGGTCTGC
AAACCGTGTCATCTCGGCGCATGCACCCAGTACGTACTCAAAGATGACCAGGAAGACAAGCAAGAATGTGACCATGAACGGAAAGAGGAGCCACGAGATC
GTCTCGCACAGGATAAGAATGGTTTCAGATGCCGACATGCCTGGGACCGCGAGGCGTTGGGACGATTCGATCAGGACAGGCAGGATAAATTCTTCACTGA
CGATGGTCAGAAGAAAGATGCAACCAAAGACAGCGATGATTTTGCTAATGAGTGACTGCCAGTCAATCTTTTCGGTGCGCGGATATTCGAGTTCGTAGCA
CAGTGTAGGACAGAAAAGATAGTCGACGTAGTTGGAGAATGTTAGATTGCGCGGGTAAGCCGTGTTTCCCATAGGACTGGTAAGCTCACGCGCAAGGTCC
TCACGGAGCTGTGAAATGTCATCATCCTCGCCGTCGACGTGCCAGTCGCCCCCTACGCGATCATCCACGTCTTTTGAGAGCGTAGAAGTCTCGAGGGGGC
TGCTTGTCTCGTCCGCCTTGTTATCTCGGAAAAATTTGGGAGCCGTTGTTCGCTTAGGACTAGCCACCTTGTTCTCGCTGGGATAGAGGTAGGCTGGTGC
CTTGGATGCCGTTGAAGGGTTATCAAGAGCGCGCAATCGCTTCTCGGTTTCTGAGAGATGGCCATTGTAGAAGACGTATGAGTGCATCTTCATCAGAAGC
ACCATGGTGTGCAGCAACAGGAATACCTGTGCAGTCCAAGTCCAGTCGAGGAGGAAAGGGGTGGCAACCCAAAGGGCCAGCCACAAAACCTCGTATATGC
TCATTATAGCCATGCCGCCACGGGCCCAGGTCAGCAAAGAGCCGGCAGGGGCAGCGCGGAAGACCCGATGCAGCGGTAGTGAAACGTAGGTACTCAATAC
CATGGCTGCATCTATCAACGCAAGCTCCCAGACCTTGACGGTGAACAATCCCCAAATCTGAACTCTCATGGGATAGCCCGTGTCTTTTATGTTACGCAAC
ATGGTTGTGATGGCCATGATGGCAAGCCCGATCCAAAATAGGTTGAAGAAGCCATGGAAGTCCCGGTAGTCGCTGTTCGGGTCGAGATGGGATAAACGAG
ACTCAAAGTCTGTCGGGGGGAACAGGCGTCGACGGCTGCGTAGGATTTCACGTTGTTCTCGCCGGACCTGCTGGCGCGCCGTTGACAGGATTTTAACCGA
CGGAGGAGCGTCCTCGGGTACTGGCGTTGATCGACCGCTA
CTGTGACGGGATAAAGAGTTAATTTTGTCCAGTTTGATAAACCATGACAGATATGACCCA
ACTGCTCAAGAAAAGCTTAC
CTGATGCTTGCGCCGTGTTCTGATGAAGCATCAAAGGTACTACCGGTATCTGAGGCGTTGCTGATTTGAGACAGTTGCGA
ATGCAACGGCTTGCGCGGACGCGGCCGAAGAACATGATCGTGATCGTTTATTCGGCCGTTAGCTCCATTCAGGAGCTCGGCTGAAGTAGTTGACAT
GGTC
TTAAGGGTTGGCGGCAGGTTGATAATTCAAGGCGGAAGCATGCAACGAGGTTTCTGCAGCTCCGTTTCCTTGGGCGCATACACCAGACGGATGAAACAAA
AACCGGCGTGGGGGAAACAATAGGCTAAAATAGCGCGGGAACAACCAAACCAGTTTGGCGTTTGCACTCGCTGTATCCAAGAGCTACTGTAGAAAGCTTG
CCAGTTGATCAAGTCTTGGCACCGTTGGCTGTCTTATTTTTTTGTGAAACAAAACTGGAGAGGATACCACGAATGACGGATTCGACGGAACTCGGCCCAG
TTGGGCGTTAGTTATATAAAAGTCACGACGGCCGAAGCGGGGTCGCTTATTTGTCCGAATCTTTGTTTTGACTTTGGTGCAAATATCAGCAAGGGATCGA
TGGGCAGTGAGATGCAGTCACCTTTTTAGTTCTAGAAATAGTACTGTGGTGACGGCTGCGCCATCTCCAAGAGCAGCTGTTCGTGGGCTGTACTGTAAGG
GGTCCTTGCAGGGGGTCGAGGTGACGGTGCTGTGGTATCGTACGTGCGTCATTACACAGTAAACCAAGACTTTGGCCTGCGCTGATTGGTACAGTGCGCG
ACAGCGCCAAAACGGACCCACGGAGCTCCTCGGCATTGCGACATGGGCCTTGAGATAATAACCAGCACCTTGTATCTACTTCGTAGGTATCTACTTTGAG
AAGACCGCTTGGCGGTACTTTTCTCGTCTCCGCATGCCGAAGTATTTACGAGCTGAGATCGCGATCCCAAGGCTGGTTTGGAATGGGACTATTTATCTTG
GCTGTAATGAATATAAAGCCCATCACATATTCGGTGGAGGATACGGTCTAGTTTAGAAGCACCTACTTTGTAGGTTATGCACAGCACGGCGTCGGTAATG
TAAGCCGTTAGGAACTTGATATTGATTGCATGCATTCAGCAGGCCGTGTCCTGTACTCCCTGGCTTGGAACATACGAAGTAAATCGACTGCCATTCTCGT
AGGCCCATTCACGAAACCGAGCGGCGGTATGGTGAAGTGTAATTTTTTTTTTATCATGAACAAAATCGAACTCTAAGAGATTATGGCGGTTCTCAGTTGC
ACATTAGTCGCAAATAGTATCAAGTCGCCATTATCTTACTAGAGCAATTGCACATGCTAGGAATACTCTGTCAAGTCCCGGGTCAGGTGGTACGGACTTT
GTGATAGTAATGCTCTCTAGCCAAGACCAAGTAAGTACTGTGCCAACCCAGTTCCCCCAAGTCAACCTTCTCGACTTGAACGAAAACCAAGGCCCCACGT
GACGTCAAATTACTCAGTCCCGTCCTGTCCCCCATCACCATTTGCTAGCTATTACCTACCTACCTACTGCAGTAAGGTACCTACCGCCCTAGCTCACTTC
GCACCACCCCTCCGCTGTCCTGCAGGCGGGCACCGGTCCCTGCCTTAGAGATCCCGCACGCGGGGCATGTCGAAACTGGGATTGCCGGGCTTGTTCCGCC
CCGCGTCGTCGCTCCTTCGCAACGGCTGTAACACCACACCCTTTTGCAACCTGCCTAGACACATAACCCGCACCGCGTCGTCGTCGCCGACTTTTACAAA
CGCCAGAATGTCCTCCACACAACCCACTGACCGCCGCCCCTTGGTCATCTGCGGTCCCAGCGGCGTCGGAAAGGGCACCCTGATCCAGATGCTCTTCCAG
CGTCACCCGGAAACATTTACCCTTTCCGTGTCGCACACGACGCGCGCGCCGCGCCCCGGCGAGCAGGACGGCGTGCACTACCATTACGTCACCAAGGAGC
AATTCCAGGCCCTGATTGCCGAGGACAAGTTTGTCGAGCAGTAAGTGCCACTCAAGCTTACTTGAGATAGAGCCATGATGCAGATATGCATACGTACTGG
CGCATTCACAAATGGCTTTCGCTAACCCACACTCCCTTGAATCTCTGCTTCAACAGCGCCCAGTTCGGCAGCAACAACTACGGCACCAGCAAGGCTACCA
TCGAGGAGCAGACGGCCAAGGGCAAGGTTGTGGTGCTCGACATTGAGATGGAGGGTGTCAAGCAGGTCAAGAAGTCCAGCATATCAGCCCGCTACGTTTT
CATCTCCCCGCCGTCGGAGGAGGAGCTCGAGAAGCGCCTGCGGGGTCGCGGAACCGAGAACGAGGACAGCGTCAACCAGCGCCTGAACCGCGCCAAGGAG
GAGCTCGCCTGGTCCAAGACGGAAAAGTTTGACAAGGTCCTCGTCAACGACGACCTGGAGAAGACGTTCAAAGAACTCGACGAGTTTGTTTACGAAATGC
CGGCACAGTAGACAGGAGGGGGCCGCATCAGATCAGATGGGTATACTTTTTTTGCGGTAGACTCTTTTCGGCTAGACAAAAGCACAAGAAGCGACCTTCC
CACGCGATATGGGTGTCTATGATTGCCCTCGTGCCCTCGTGCCGTTGTGTTTATCGTATCTCATCCACTGTGCAGTGGAAAGCGCCAATCGGTAGTCCAA
CATGCGACCCTCGGTATCGTGGTCTAGCCTTATAGGGCACATGCCGCGTATCGTCCAATCTACGTTGCATGCCCACCTACGGAATACTACTTACTCCCTT
TATAGTACGAAGGTTGAAGGGGTAAGTTCCAGCACCCTGGCACAGTACAAACCTCATGGAATTGCCCTAACGGCATATGAATTTTTGGGCTAAAAAGGAT
TACAAAAACTGTGCCACGCTCACAGAACTTACCCATCTAATCTCTGTATGTTTATTCAAGCAACATCGGCCAAAATTTCCTAGCCATTACACTACCTAAT
AGCAAACTGGAGTTTCTCTCTTGTTATTTTTGGAGATCTCACACGATACGACGACCTCGGCTGCACGCTGGATCAGCAGGGTTTCAAACGCTATATATTC
ATTAGGATAGTATCATGTTCATGTATGCCTCCTCGGTTTACAGTAGTACAGCAGAACTCCTTGTCTACCCCGCTAAATGGCGACGCATATTTCCCTCTAA
ACATAAGATTACCCGGCACGAACGCCTCCAACACCAAACGCCTGATACCAAGCCAAGTCGTCACCTACCCAATTCGTGTTTGCCGCAAATACAGTTCTGC
CGATATCTAACGTTTTCAGCCATCCATCTTCACATCCCCATCCTTGCTACTATCAAGATGCTTGAGAAGATAGCTGCGTTTGAAGTACTCGTTGGGATGT
ACGATGGTTTCGAGCTGTGCCACGGTCATGATGCCCTCGTCCTTGGCGCGTCTGATCTCGTTCTTGTGAACATATTCAAAGACCCTTGAACAGAGATTAG
CAACTGCTAGGAACTAAACACATAAGCATGAGACAAACAAGAAGAAAAAACATACCTGTTGCAAGCCAGATGGAACTTTTGCTTCTCTTTGTCTTCTCTT
ACCCCGTTCAGAACCGAACGGTCGTTGATGCCGACCTGCTGCAGCAGCGCCGTCAGGTTCTCCAAGTTGAAGTGGCGGTACGGGCACCCATGCGCCTCAC
CGGGACCAGGCGGGTGTTCTGTCAAGATCTTCTGACAGCTGAACGGACTGTAACCGCGGCCTCTCCTGTTGGCGTCGCCGCCCACATCGCCATAGACGTG
CCTGACGTTGTACCTGTACTCCTTGTTGAAGGTATCATCGGTAATCTTGTTGAAGGAAGAGCGCCAGAACACCAAACACTCCTCGAGCGAAAGGCCGATA
CCCTTCAGGAAAAGAGAGTATTGTAGACGGCCAAAGTGCTTGAGGTGAGAGTCACGACGCAGCGAGCGATGCAGGTGTTGCATGCAAAGCGGAAAATGCT
CCGAGGAGAGTTTGTCCACGTTTGCTGCTGTCAGTTCAGACCCCGGTGCGGCCTGGTCGTCGCCGCCGCTGCCGTATGATGCGTCTGGAGTGATGAAGTT
CTTGGAGAGGTGGTTGAGGATCGGAGTCAGGCGGTCGTCTTCGTCGAGTCGGGGAAGGGCGCGAGCAGTAAGCTATATAGGGGCGAGAAATGTTAGTCCT
CGTCACAATGGAAAAAAAAAAACGTGTTTCAGACTTCATAGCTCGTGGATCCGTACCTCGAGTGCCTTTTCCAATCGCGAAGTAAACTCGGTGACTACCA
TGCTTGTCTGCTCCTTGGCAGGCACGTAAGCCTTGCCCGCCTTCAGCAGCACCCTTCTGCCTTCCACAAGGTCCGGTACCCTTTCCCAGTCAACTTTGCA
CCACATCTCATCGTCTCCGGCAGATTCCTTCTTCCATCCTGCAACTGCGGCGAGTTCTGCCGATAGACTTCTCCTCTCATCCTCCGGAACGGGCTCCCAT
TCCAGGCCGTCTAGAGAAGCGATGAAAGCAGCGCGCTCTCGGCTGTCGTCTGCCGCCAGCCGCATCCGAAAGAGCATAGTCTCGACCCTGACAAACCTCC
TCCTCAAGTCCTCAGTGGAGCAGAAAGCCAGCCGCAGGATAAAGTGTCCATAGTGGTCCTTCTGCCTCTGTGCGTGCAGCTGCGTGGAGGCGGAGCTGTT
GGCCTCAAGCGGGAGGTACTTGTCGAGCAGGGGCTTCATGTGCAGTGCCGTCTCCTGCGACGTCTTGTTGCGGAAGCTGCAGGCCTCGAGCTCGGCGAGG
ATGCGAAGTCGGTCGATGGCCCATTGTTCAAACTGCTCCAGCGTAATGTCGGCCGTCGGGGGGATGGCGTAAAAGTTCATACGGTGAGGGTAATCGGTCG
CCTTGTAGGCCGGGTCGGCGAACTGCTTCTTTCGATGATCGGTGACATTGCGCCGTTTGGCGTCTGGTCGACTAAAGTCCTGCCTGAGCATGGCGATTTT
TATGGAGTAGTGGAGAGTCGAAGTCTATTGGTACGGTATTAAGTACTGTTAGGCCTTGATGTTGATTTCTTGTGATCCCGGTATGCATGAAAAGAGTTAA
CTCATCAAACATTGATGATATTGTGGTCTGCCCAGAATACCTACCTAGGTATCTAGCGTCGGTGTACTCGAATTTACTACTCTACGCGCTTTGCCCAAAA
AAACACGCGAGTCGACGCGCTCTGGGCGGGGTGGGAAAAAAGTGGCGCGTCAGCTCAAGTGGTAATTGGGAATGGGCGTGGTAACTCCCGTCTGCAAGCT
CCTTGGTGCCACCACACCCCTCTCTGTCAGAATAGACTAAAAGCAAGCGGGGCGGCCTCTAAATTGAGCTTAACCTCGCCAACGGATGATGGACAGGACT
GACTGCCCGATCCCGCCTTTTCTGCCAGATCTGAAAGCACTAGTGTCGATAGCATAGCCGACGCTAAGCCGTCGCCTTTTTGGGAAATGCATTTACCCTC
ATGCCACCAGTCAAGCAGTTCACCCTTCAACTGAAAAAAAGTAACAAGTGAGTACGCTATCAAGGCATGTGGGCAGCTAGCTCAACCGGGGAATCCCTAC
TTGCAATAAAAGCTGGCAGGTAATTATCAGGCGTATGTAGCAATGTACGGTATTCAAAATTGAAGGGACTCGAATAATTCGGCTGGCAAGTGGAGTTTAA
GTGGTTGAGCGCACGTGATGGCCGTATGAGGAAGTGCGCCCGGTTTCGTGCATGGGGAACGAATCTATTCAAGTCCCACTTTGACTTGAGACCCTAGAAA
TCATTCTTGGTGAAGGTCCAATCAATCTCAAAATCGGCCCTCGGCCACCCATTTGCAAGGTGTGCTAGGTGTATTGATACCTACATATGTGTGCCATCAA
GCCTAGCCTAGTCTCGGCTGGTCTGGTTCACCGGCTGCGCTAGGATGAAAGGGGGGGTTGTGTTCCCTCCTTTTTCCAAACTCAACAGAACCACGCCGTC
GGTACTTGACCTGGTTGACCTGACCTAACCGGGCCTGACCTGACTTGTCCTGTCCCCGATCCGACGCACCGCCCTCTACCTAGGCCCAATCTAGTCTCAG
TTTGCCTCCTCGTCACAACCCGGACTTTTACTTCTTTCTTTCCATCCGCAACCTTCTTCTGCACGCTCCTTGTCACTCATTGTAAAGGGGCATCGCCCAA
CCCAAACCAAACCCACCAATCGTTGGTTCATCCATCGGTCGGCCCTTTTTAATACTTACTTTGGTTGCAGGCCTTTTTTTTTCTTGCTGCACAATTATCC
GGCCAAGATACAATCAAACATGAAAGCAGCATCATTACATACATTGCAGCTAGTGTTATTGGTGGCAAAGGATTGAAGATCCCAATTCGTCTCCATGCAA
GTGAACCACGGACGGCCGGCATTTTATCACTCACTCGCAGACATGACGATGATGCCCACCGTCGCAGCCATGGCCAAGGCTGGGATGCCGTCTGCACGTG
CATCGCATGCGCCAATGCATGCTGATGAGAGGACCGAACATGGCACCTCACAGCTGAATGCACTGGCCACGCCTCAGCCTTGGCCTGCCCAGGATCGGTG
GGCTGAGCTCCGGCCTATAATCACCAGGTTGTACAGAGAGGAGAATAAGACTTTGAAGGATACTATGGAAATAATGGAGCGGGAGCATAATTTTTCTGCC
ACGTACGAAAATAGCCCCTCTCCCATCCCGCTCCATATCATCATGTCGTTTCTGGTTAATTTATTAACATTCCCGCGCTGCCTAGGGCGAGGATGTACAA
GACTCGCATTAAGAACTGGGGTCTGGATAAAAAATTCAAGGCAAAGGAGGTTCTTGTCATGCTCCAAGCGCAAAAAGAGCGCGAGGGTGACAACAAGGAG
ACTGAGTTTGTTGTCCGCGGCCACAAGGTCGACCAGCGTCGCATGAAACGCTACCTGCAACGCAACAAAATCGTTCTAGATCGTTTCAAGGAAGGCGATC
TGCCGCCAGACGACACCGCTACTACGTTCAAATCGTCGGTCTCTGGGTCGCCGGAAGGCGGCTCGCCAGAATCCCGCTGCAGTGCTGGCAGCACTGGTAC
CGGTCGGCTTTCTAGGGGACGTCGAAGTTCGGGTGTCGTCGTCCACGTACGCACACCTTCGCCGGAACCAGTGAGCAGCTCATGGCAGTGCGTCACAACC
GAGCCGAACTCGCCAAGGCCCACGCTCGGCCTCCCAGGTCCAGTCATAGATGCAGAGAGGCTCCTTCACGCAGTGAGGTCATATATTGGGGGCTCATTCG
CAGCTGGTACATGGTTCTATGATGCCTTTGGACGCATCCAGAGTCGCAAGGGAGGCACCGCCGATTCTCTTTTGCTTGACACCTGGACCAGACTCGAGGT
TGTGGCCTCGGGCATGGCTACGAAGCAAGACGTAAAGGTCTTTGGTACATTAAATCCAGCCTTTGAGTCTCTGCAAGAAATTGTACGAGAGGAGGCGCCA
CTTCTCATCAGTCGTATGCTACGGCTGTCACGCAAGCTCGAACTGCTCCAAAACCGCCAACTCTGGGCCGTCCTGGTTGAATACATTGGCGAGCAGACGT
TGCGAATCCTGGGCCCAACTCACGTTATGAACATCATATGGCAGCAATTTCGCGACATGGATGTGGGGACCGACGAAGAAGTTCTTGACCGCGCCTTCAT
GCTCATTGTTGCCGAGTTCGATAGATGCTGCCCATCCGCGACCAACTTTGGCGTGCTGGAAGCTTACCGGGATCACTTCGACACCGTGTCGTCTCCCTCT
CGCCGTCGAAATTTGGAGGCCCAGGAGCTGAGTCTTCGTCAGACACTGGCACTCATGCCAGCGCACGCAAGTGGTACACCTCCGTTGCAGGGCTTGCTCC
TGCGGATGCGCATAACCTCATCTCTTGTCGCTTGTGAGAGGGGCGAATATGCACGCGCCGAGAACATCCTGTTTGACACCTCATTCGCTGAATTTGGATG
CCTCGGTCCTTGGGCCGTTGCTTCGCAGCATGCAGCCCTCGGTCATATACTGGTCGCCAAGAAAGACTGGGTTCGAGCAGAGCAGGCATTTCTTGCTGCC
GTCGCACAGGTCGAGGGCGCTACAGGCTATCAGAACGAGAGCTGCTGTGAACGTATGCTGGCAAACCTCGAGCGCCTCTACACATCCACGGGGCGATATC
ATGACGCCACTGAAATGCGCGACCGTAGATTGAGGAGGCTGCTACAGCAGTCACAACAGCTCGGTCTGTCGCGGGGGCTACCCTTCCAGGCGGAGCGTGA
AATAATGCCATATTCAGTGGTGAAGTTGGAATCTCTAGACAAGTTATGACTGCGTAAAGTCTGGGATTTCTAGCTTCCCTCTTCGCCTAGGCGGCGCGAT
ACACCTACCTATACACGCATGTGCTGCTGATAGCTGTACAAGAAGCACCAGTATCAGTGCCGGGCGGCATAGGAGGTCAAGTATCTCTGAATGGGCAAAC
ACAGAGTACAAGTCGATTCGGGCCTCTTTTTCTCCCCTCTGCGGGATGACCGGGTCCTTTGAAGAGAGTAAACGGGACGTGCGTTGGCTCCCAGTGGTTC
CTCTACCGAGAAAGCGGCAGAGACACCCATCGATACCTGCTGAGCGTAATAAGCGAGCGCGTTCCCAACAACTCACCGAGAACTGCCAGGCACTTGACTC
ATGGCATGTCCCAATGGTCAAGGTCGGGACAGGGCACAGTGGATTGGGTTTCATAAGGGCACATATTTGGCTCAGTTCCGTCTGTGCTCAAGCGACATTC
TGTCCACATAATTGGTCTATGGTCAAACTGCCGCAATGCTTGTAGGTATGGATAGACCAAATAACAGAATCGCCTCGTCCGATGAGCTAGTTAGCGATTG
GGCTGCTAATGCTCCGGTTGCTCATTACTGGCTCAAGATAAACAATGGCATTTGTGGATTGAAGCCATGGTCTTTATAAGCCAAGAACGGTTCCCCGCAT
TTGGAAGGGTCGTGGTGACGCCGTGACGCGAGGTCCATATACGGTACGGTAATATCTAGTGTGCTTATGTGGGAATTTATGCCACATTTACGCATGGTTT
GCCTCTTTGGGGAGGTATTTGTACGGGAGCAGGACCTGTAAAGAACCCACCAATGCGTACTCGGTACAGCAGCAGTTCAAATAGAGCAACGAAAACAATA
AAATCAAAACCCCAGCGTTATACCGCCAACTAGGCCTTTTTTGGGTTTGGTTCCAAAGGTCCTTCGCCAATCAGTCATGTTTGATTGAGTTTCTTCCCCC
ATTGAAAAGGCGGCCCGCTGCTGACAGAAGTCATAAAAGACGATTATCCTGGATTTTGCCCGATTTTCCCATGCAGCCAGGGGGTTAAGGATGGAGGCTT
GCAGCACAGGCAATTTTGGGAAGTACGATTTCAAGATTGAGGATGCATCCATTGGGTGATTTTGAAGAGAAACACGACATTTCTTTGCTGTAACGAAGGA
AGCATGTAGCGGCAACCTGCGGTCCATTCGGTGGGACCCAATATCCCGGGGCTTTGTTGGCTTGCATGGTCTCTCTATTTGTGGGCTGAAAAGGGACCAT
GCATTGAAATAGCCGAGTGTTGTTGGGTTATTGTTAGTGGTTGATAGGTTTTTAGTCGGGAGGTACAATTGTGAATTACCTACCTAGGTACCTACCTACC
TAAACTATCCTCCCTACCTGACCTGCACATATTCTTTACCATCCGACCGAGGTGTTTGACTCAGTACAGTTCAGTATCTAATACAGTTCTGTTTTGTATA
CACACCTGTGTTATCTATCCGTGATGCTTGAATCGAATTGAATGATATTCCCCCCCAAAAAAGGTAGCTAGGTGCGTTTGTTTACCCGATGTGTCCAGTA
GCCTTACCGCCTTGCCAAGCCTTACCTACTACCCCCGGGACAGTAGCGTAGTTTGGATTACCAGGTTAGCTTTATAGCCTATCCCCGGCTTTGGATTGGA
Copyright 2006 Fungal Plant Pathology Lab. & FBL
E-mail : yonglee@snu.ac.kr
Magnaporthe oryzae ATMT Database