Home   Guide to ATMT Database   Sitemap   Contact  
Sequence ID  5330652
Locus Name  MGG_06650.5
Gene Name  
Protein Name  hypothetical protein
Species Name  Magnaporthe grisea [Magnaporthe oryzae 5 PROTEINS]
Protein Sequence
[450 aa]
+  1
101
201
301
401

MREIISINVGQAGCQIANSCWELYCLEHGIKPDGFLTDERKAADPDHGFSTFFSETGQGKYVPRTIYCDLEPNVVDEVRTGTYRSLFHPEQMITGKEDASNNYARGHYTVGKELIDQVLDKVRRVADSCSGLQGFLVFHSFGGGTGSGFGSLLMERLSVDYGKKSKLEFCVYPAPQTATSVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRSLGLERPNYENLNRLIAQVVSSITASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVAYSPIVSAARAAHEANSVQEITMSCFEPNNQMVKCDPRNGKYMATCLLFRGDVVPKDAHAAVAMLKTKRSIQFVDWCPTGFKLGICFEPPQQVPNGDLAKVNRAVCVLSNTTAIADAWSALSNKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALERDYEEVATDSLGDEEGIEAEY
NNYARGHYTVGKELIDQVLDKVRRVADSCSGLQGFLVFHSFGGGTGSGFGSLLMERLSVDYGKKSKLEFCVYPAPQTATSVVEPYNSILTTHTTLEHSDC
SFMVDNEAIYDICRRSLGLERPNYENLNRLIAQVVSSITASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVAYSPIVSAARAAHEANSVQEITMSCFEPNN
QMVKCDPRNGKYMATCLLFRGDVVPKDAHAAVAMLKTKRSIQFVDWCPTGFKLGICFEPPQQVPNGDLAKVNRAVCVLSNTTAIADAWSALSNKFDLMYS

DNA Sequence
[1353 bp]
+   1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
ATGCGCGAGATTATCAGCATCAACGTCGGTCAGGCTGGTTGCCAGATTGCCAACTCTTGCTGGGAGCTCTACTGCCTCGAGCACGGCATCAAGCCCGATGGTTTCCTTACCGATGAGCGCAAGGCCGCCGATCCCGACCACGGTTTCAGCACCTTCTTCTCCGAGACTGGCCAGGGCAAGTATGTCCCACGTACCATTTACTGCGATTTGGAGCCCAATGTCGTCGACGAGGTCCGCACCGGTACCTACCGTAGCCTGTTCCACCCCGAGCAGATGATTACCGGCAAGGAGGACGCGTCGAACAACTACGCCCGTGGTCACTACACCGTCGGCAAGGAGTTGATCGACCAGGTGCTGGATAAGGTTCGCCGCGTTGCCGATAGCTGCTCTGGTCTCCAGGGCTTCTTGGTCTTCCACTCGTTCGGTGGTGGTACCGGATCCGGCTTTGGCTCTCTCCTTATGGAGCGTCTGTCGGTCGACTATGGAAAGAAGAGCAAGCTGGAGTTCTGTGTCTACCCGGCCCCCCAGACCGCCACCTCCGTTGTTGAGCCTTACAACTCGATCCTTACTACCCACACCACATTGGAGCACTCTGACTGCTCTTTCATGGTCGACAACGAGGCTATTTACGATATTTGCCGCCGAAGCCTCGGTCTTGAGAGGCCCAACTATGAAAACCTGAACCGCTTGATCGCTCAGGTCGTTTCCTCAATCACCGCCTCGCTCCGGTTCGACGGCTCCCTTAACGTCGACTTGAACGAGTTCCAGACCAACCTGGTGCCTTACCCCCGCATCCACTTCCCTCTGGTCGCCTACTCCCCGATTGTCTCGGCTGCTCGTGCTGCTCACGAGGCCAACTCGGTTCAGGAGATCACCATGTCTTGCTTCGAGCCAAACAACCAGATGGTTAAATGTGACCCTCGCAACGGAAAGTACATGGCCACGTGCTTGCTGTTCCGTGGTGATGTTGTTCCTAAGGACGCACATGCAGCTGTTGCCATGCTGAAGACCAAGCGTAGCATCCAGTTCGTCGACTGGTGCCCTACTGGCTTCAAGCTTGGTATCTGCTTCGAGCCTCCTCAACAGGTCCCTAACGGTGATCTTGCCAAGGTCAACCGCGCTGTCTGCGTTCTCTCCAACACGACCGCCATCGCCGATGCTTGGTCAGCCTTGTCCAACAAGTTCGACCTCATGTACTCGAAGCGTGCGTTCGTCCACTGGTATGTGGGTGAGGGCATGGAGGAGGGAGAGTTCTCTGAGGCTCGTGAGGATCTCGCTGCTCTCGAGCGCGATTACGAGGAGGTTGCTACAGACTCTCTTGGTGATGAGGAGGGTATTGAGGCGGAGTACTAG
GTTTCCTTACCGATGAGCGCAAGGCCGCCGATCCCGACCACGGTTTCAGCACCTTCTTCTCCGAGACTGGCCAGGGCAAGTATGTCCCACGTACCATTTA
CTGCGATTTGGAGCCCAATGTCGTCGACGAGGTCCGCACCGGTACCTACCGTAGCCTGTTCCACCCCGAGCAGATGATTACCGGCAAGGAGGACGCGTCG
AACAACTACGCCCGTGGTCACTACACCGTCGGCAAGGAGTTGATCGACCAGGTGCTGGATAAGGTTCGCCGCGTTGCCGATAGCTGCTCTGGTCTCCAGG
GCTTCTTGGTCTTCCACTCGTTCGGTGGTGGTACCGGATCCGGCTTTGGCTCTCTCCTTATGGAGCGTCTGTCGGTCGACTATGGAAAGAAGAGCAAGCT
GGAGTTCTGTGTCTACCCGGCCCCCCAGACCGCCACCTCCGTTGTTGAGCCTTACAACTCGATCCTTACTACCCACACCACATTGGAGCACTCTGACTGC
TCTTTCATGGTCGACAACGAGGCTATTTACGATATTTGCCGCCGAAGCCTCGGTCTTGAGAGGCCCAACTATGAAAACCTGAACCGCTTGATCGCTCAGG
TCGTTTCCTCAATCACCGCCTCGCTCCGGTTCGACGGCTCCCTTAACGTCGACTTGAACGAGTTCCAGACCAACCTGGTGCCTTACCCCCGCATCCACTT
CCCTCTGGTCGCCTACTCCCCGATTGTCTCGGCTGCTCGTGCTGCTCACGAGGCCAACTCGGTTCAGGAGATCACCATGTCTTGCTTCGAGCCAAACAAC
CAGATGGTTAAATGTGACCCTCGCAACGGAAAGTACATGGCCACGTGCTTGCTGTTCCGTGGTGATGTTGTTCCTAAGGACGCACATGCAGCTGTTGCCA
TGCTGAAGACCAAGCGTAGCATCCAGTTCGTCGACTGGTGCCCTACTGGCTTCAAGCTTGGTATCTGCTTCGAGCCTCCTCAACAGGTCCCTAACGGTGA
TCTTGCCAAGGTCAACCGCGCTGTCTGCGTTCTCTCCAACACGACCGCCATCGCCGATGCTTGGTCAGCCTTGTCCAACAAGTTCGACCTCATGTACTCG
AAGCGTGCGTTCGTCCACTGGTATGTGGGTGAGGGCATGGAGGAGGGAGAGTTCTCTGAGGCTCGTGAGGATCTCGCTGCTCTCGAGCGCGATTACGAGG
Position in Contig 2442494 ~ 2444421 (1928 bp, 575 bp) in Magnaporthe grisea 70-15 supercontig 5.186 (Strand +) (Frame : 2)
Chromosome Chromosome : Not defined!
Contig Sequence
(2432401 ~ 2454400)

+2432401
2432501
2432601
2432701
2432801
2432901
2433001
2433101
2433201
2433301
2433401
2433501
2433601
2433701
2433801
2433901
2434001
2434101
2434201
2434301
2434401
2434501
2434601
2434701
2434801
2434901
2435001
2435101
2435201
2435301
2435401
2435501
2435601
2435701
2435801
2435901
2436001
2436101
2436201
2436301
2436401
2436501
2436601
2436701
2436801
2436901
2437001
2437101
2437201
2437301
2437401
2437501
2437601
2437701
2437801
2437901
2438001
2438101
2438201
2438301
2438401
2438501
2438601
2438701
2438801
2438901
2439001
2439101
2439201
2439301
2439401
2439501
2439601
2439701
2439801
2439901
2440001
2440101
2440201
2440301
2440401
2440501
2440601
2440701
2440801
2440901
2441001
2441101
2441201
2441301
2441401
2441501
2441601
2441701
2441801
2441901
2442001
2442101
2442201
2442301
2442401
2442501
2442601
2442701
2442801
2442901
2443001
2443101
2443201
2443301
2443401
2443501
2443601
2443701
2443801
2443901
2444001
2444101
2444201
2444301
2444401
2444501
2444601
2444701
2444801
2444901
2445001
2445101
2445201
2445301
2445401
2445501
2445601
2445701
2445801
2445901
2446001
2446101
2446201
2446301
2446401
2446501
2446601
2446701
2446801
2446901
2447001
2447101
2447201
2447301
2447401
2447501
2447601
2447701
2447801
2447901
2448001
2448101
2448201
2448301
2448401
2448501
2448601
2448701
2448801
2448901
2449001
2449101
2449201
2449301
2449401
2449501
2449601
2449701
2449801
2449901
2450001
2450101
2450201
2450301
2450401
2450501
2450601
2450701
2450801
2450901
2451001
2451101
2451201
2451301
2451401
2451501
2451601
2451701
2451801
2451901
2452001
2452101
2452201
2452301
2452401
2452501
2452601
2452701
2452801
2452901
2453001
2453101
2453201
2453301
2453401
2453501
2453601
2453701
2453801
2453901
2454001
2454101
2454201
2454301
TTTTTGAGAAAAGAAAGAAAGAAAGAAAAAGTACTTACGGCTCGTTAATGACCATGACCATGCCGTTCTTGCAGTGAGGGCCAGTGGCGCAGTACAGCCA
GATGGGGTTGGTGTTGTTGACACGAATGGTGTAGACGGGGATCTTTCCCATGGCGGCGCTAGCCGCGAAAGGAACGAAGCCGGTATGGACGCCGGTCACG
TTCTTCATGGTCTTGCTGATGGGCTGGCAAGGGTCGTCGAAGGGCGACTGGGTAACGGTGTGGTTGCCACCCATGAACATGAACTGAACCATGTCGCCAGTACGAGCGGTGATCTTGTTGGGCGAGAAGATGGTGCCGTTCTGGCCAACACGGACAGCGTGGACTTGCTGGGCATCGACACCAGTAAACATTGCCAGGGCGGCGAGAGCGACGGTAGCGAACTGCATTTTGAAGTTTAAAATTGAACTTCTTCGGTTGACACCTTCGGAAAAAAAATAATAAGTAGTGGATGGTTCGTCGAAAGACCGTGTTGTTTGCAAAAGAGGATAGAGTAGAAGGAAGCTGTCGATCGGCGGCTCGCGCGTCAAACAGTAAGGACTAGCCTTTGAAGAAAAAAATTAAAATTTCAAAGATGAGCCGAAGAAAAAACGATGGATCTCTGGATGATGGAGACTGGGAAGGAAGATCAGAGCAAGAACACCTCAAAAGGAGGGAAGATGGCATGAATATATGGGAACTTTGGGAAGAGCTAAGCCGGCTGCGCCAAGAATCACCAAATTAGAGACAGCCCCATCAGAGGCCCCCATGTCGGGCGCCGGGCAGGGGTATGAAGACGGATGCTTGAAACATCAAGGTAATCCGTAGGGGTGTGGGTGTTTTGACCCGTCACCGCAGCCCTGTCTACTCCACCGTCTCCATCGACGAGGAAGAGGGCACCCAAAGGTTGCTGTGCCGATATCCTAACCTAACCTAGCCGTAAAAGAAGTTGCTGAAGCGAGGAACAATAGAAAGAAAAAAGAAAAAAAGGGGTGGATGTTTGTCCAGATGGAAATGGGCGTGACGTGTGTTGGGCTTTGGAACAGGCCGCTGCATACTAGTCTACCTAGTGATACAACTTCAATCAGGGTGAAAATCACCAATAAGATAAACACAACTATTCTCAAGTGGCATGCTCTCTCGGGGAGCTAAAAGCGATTGACATGGTGCTGTCAGTTGTACAGGTAGGCAAGCGCAAACCAGTCGGTTTAGCGCCACTGCATTGAATTGATTCGACAGAAAGAAGGAAAGTGAGATAACATTGGGGGCATAGAGAGCCAGAATAAGACATGGATGTGACGGAATTTCAGGACACATGTCTGTTTGCCTGTCAAGTCTAGTTGGGAACGGAATTTCTCAGCCTCAAAGAGATCACCTACTTCGTACACATCAACCTTCATGTATCACAACACACGAATGTTTTCGTCATGAGATACCCAATCAAACGCCAGTAGCCAGGAACAAGGCGTAGCATAGCCACAGGCTGATTGGTATTGCAAGTATGAAGTGTACGTAGGCTTTGATATCGGGACTTGAGAGCGCCGTCCTGGCAAAGGCTTGGTTGGTGCGAGTTGAAGCTGGGGAACCGGGACTTGGGAAATTCCGGGGTTGAGACGTTGTTTAGATTGCTTTTAGTAAGGTTACCTTACTCCTTAAAGTCTTTAAGCTCTTAGAGGATGAAAACCTTGAAAAGGTGGGGTCATGCCCCTCGACATGGTCCAGTCAATTGAGCTAACGAAAAAAAATTTGTTCCCAAGGGGTAAGGACAACCCTGAGGCGACCCAGACTCCGAGGGGAAATGGGGCACGGATGTGCATCATGCGATGAGGATGAAACAAGGCTGACGCTCGACAACGTCTCACTTAGCTCCCACTATCCCGTACGACCTGTCGTGCCTACCCAGACGTCAAATCTGTGCTAACCCTTTCATATGGGCTTTTCACTCGCCACAGGAGCATGCATCCACAGCCCTTTGATTGACCAAGGGCCATCGATGCATCTACGTAATAACAGGTTTACCTCTTGTCTGACTGCGAACGACTGACTATACTGTGACACGACCAGCATGAGCCCTTGAAATAATAATTAATATATGCAAATCAAAACCATGTGCCTAAACGACGTCATCTTGATTGAACGATACTGACTTGAAGTGAAAACACGGGCGGCAGACCAGGCACATCGGGACTCGGGAACATGATGTGAAAGTACAGAAACAAAGCATCAAAAAGAAACAGCAAAAAAGAAAAAGAAAAAAAAAGAGATCGAGGGGCGCGGGCAGACTCCTTGTCTCAATTATTTCAAGCCACTTCCGCTTGCCGAGCGGATCACCAGATCCCGGCTTCTGTGTGCCGCAAGCAGTCACGAAGAAAAAAAAAGCTGAGAATGTTTCTCTGTTTCTTATTGGTCGGCAACTGGGATTGGCTGATGATATATCTGGAAGATCTTGGAAACACAACGGCCTTTGTTTCCACATGGCGGTTTGGTCATCAAGGGGCGTTACATGCATTGTTCTGTTTGGCCAGGTAGCTACCCTGGTATCACAGGCAGGCCATTAGAGGCAGCCAGTGATGACAGCTCCGCAGACGAGCCACCTACGCTTTTAGATCTGGACGCTGGCTCCCTCCTGATATGCCACAACCATATCTCACCATCTGCCGGCGGCTATCCAGTATCAATAATGGTTGACCAACTCGGACATGTCATCACCTGAGACGATCAGTGTGTTATACCCTTCAGCGAGAGCTGTTGGGCATCGTCTGGCACACAATTCTCGACCTCTTTTTTGTACAGCGATTGATTCGTCCCCATTAATTCGGCTTCCCCCGCCGTCGACCTTCGAGCAAGGGACACGCATGCCTCGTACGATCCCAGCGGTCCCCAGATACCAGCCTTGAAAATCCATAGAACTTCAAAATACCTTAAGCTCAGTTGCATAGCCGACAAGAGGCTGGATTGCGATCGACGCGTGTCAAGCGATCAAGTCTTGGCATAGAAACTCCCGAGGATCACCTGGGCAAGCGAGCCGGCAGCCCTTGCACTGCCTCACGAGTCAGAATCCGGCCCAGTTGTCTGACAAAGCAAAACAAGACGTGGTCCTCCAACGAATGCACAAGTGCATGAGATGCAGCAAGCGTGTCTATCTATATTCAAAGTAGGTATACAGTGTATGGGTGGATAACCGATATGCGTAAATGAACATTTCAAGAGCTTAATGCTATTGGCCGTGGGCATATTGGATGGGACAGGTTCGAAAACACCCCACAGGACCCGTCAAAGATCCGAGTAGCCGAACAACTGTTAAACTACCTATAGTAGATTATCACTTGGGTGACTACACTGAGGGAGCTTCATGTCTGTTTCTAAGCCAGTTGTACTGTCGAGATTCTGTGACGTACCTGTGCTTTGTGATTCCCTTTCTCCTTCTTTCACCAGCCAACCCCAACCAACTAACAATCCTTTCACTGGTGCAGCTCTCATCTATTCTTCTTTTTTCCATTCACGCTATTCTGAATACCCGAGGGTGGGCCCAATCCGTCCTAATGGGTTGGCTGGAGCGGATCATGCCTGGTTGTTCATGGAGCTGAAGAGACGTACGGTATGGTATCGCCAAAACTAAAGTTAGACCATGGCGAGCACATCATCAACAAGGCGCAATCCGAGTTCAAGCAGCAACACTCTAGACACAGACATGATCCATTTCTGCAACTCGGGGTGCAAAATCATCATAGACACTCCACTAGACTAATAATAGTACCGACCTACATAGTAGGCAAGGTAGTGAGTGAGTGTATGCGTGCTTCACGTGACACAGACCCCCCACATCCACACAGGTCGCCGTTTCCACAGTGACGGGTTTCCTTGGAGTGGAGCTCCGCAGTAAACATTGCATTATTTGGCAAACCTGAAAATCACTATCGTTCGTGAGTGACCCTTACCCAAAAAAAGCGAGACCAGGCCACACTGCCACGCCACTTTCTTACATTGATCGCATGCGCACGTCGTACTCCATTCTCCATTGACTTGTCTCTGCCAGGCCTATATCGTGCTGTGTTTTATCACCAAGTCAGCACCAAGGTTTCTGGGAAAAATAGACATATTCATAATCCCCAACGGACAGTTACTAGAGGGCGGCAAACAAAACAAATCCCACCAAAGCAAATCCAGCGCCAGGCACCTGCCCACAAAGTACAACATTCCGCACCCTATGAGTATAGTCTTGCGACGATAACAATCATGGACCCGACATCGGGTTGCCCACCGTCGCCCTCACCCGGCACGCCACTCCAAACAGCCTCGGCAGATCGTGTTAATCACCAGCGCGAGCAGTCGCTAGCATCGCCGTTTCAGCAGTCTTTGACGAACACGCCTGGCCGTGACCACTCCCGCGAAAGCTCAGTCCATGATAAGATCAACCAGTTCAACAACCTTGCCGTACACTCCAAGCAGCTGGAACGCAAGACTGCCGATGCGGCACTCAAGCGCGCCATGCTAGGTCGCGAGGAGGCGGAGGCCGAAATGCGCAGGCATCGCGATGAGGCGAAGCTGCTGCGCAAACAGGTAGACGAGGGCAAGGAGCGAGAGAGGAGGGTCGGAGAGAGACTGGAGACTGTCATGGTACGCATATAACATACCTTGCCCACGAGCAGTAAATCCTTCCATCCACCAACAAACAATGTTTACTAACGCTCAGCGAATCATTGACAGGAAAACTATGGTCGCGCGAAAGAAACACACGCGCATACCCAGGCTCTCTGGGAGAAGGAGATTCGCCGCGCGCGCAAGGAAACCTTCAAGTTGCAGAGCGTCATCGTCAAACTCCAGGAGGAGCTCAAGTCTGCACGCGCTGCAGCCAAGACAGCCGAGGAAAGCCTAGCCCAGGAATCCCAGAGAAGGGAGGACCGAGAGCAGGAGGCCTTTAGTGCTCGATACGGCATTGCTGAGGTTCAAGAGAAATTCGAAGAGGCACAAGGGCGCATCCAGATATTGGAACAGGAGTGCGATGTCATCAGGCAGGAACGTGATGCTTTCAAGACATTGGCGAAAACGGAGGAGGACGTCGCCCGAATCGCGGCAGAAGGTCGGTTGCCACTCCCAAAGTCGAAACCAACAGAGGGTGAGGAGGAGGACGAGTTCACATCCCCTAAGAAAAAGAGGCAACGATTGTCATCTTCTCCACCACCGGTTGAAATCAGAACATCTGAAGCCAACGAGGCTGAGCTGGAGGAGTTATCCTTCTTACTGCAGTTGGAGAGGCAGCGGGCCGATCGAGCGGAAGGCCATATCGAGTATCTCAAGGCCGAGTGCCAGCTTCGCATGTGTCCATGCATGAAGTCGCGGCCTCGGTCGAGCATTCTCTCGCACAGGTCCCCTGCTAAACCCGCCCTTGCGTCTCCCCAGAAGAAAAACCGCATCGAGCATCTCAAAATAAGATCGGGACCGAGGCGAAGCACCATTTTCGTACCGGAGGAGGGCGTCTTCCGCACAGTGTCGCAAGAGGAGGCGGAGGCGCTAGAGGCGCCGTCGATTCCGGCCCCTGAGACCGAGGATGTCGCCGAGGCCACGGCAGAGCCTATTACTCCTGACACTCCTGCTGCTCTGAAAAAGAGTCCAGAGGCTTACGCAAGAACGCCATCCCTGGACCCGCCGGCTTTCGCCATGCTTTCGGAGACTAGGGCGTCACTTCTCTCTCTCCTCGACGCGCCACATCGAGCAGAGCCACCCATGACATTTCATGTCCCTACCATCCCTGGTGTGATATTTGAGGAATCAGTTCAATCAGTCGCCAAGAAATCCGTCATGACAATTGACTTGAACTCGCCTCCTGCGGAGGAGACCCGAACTGCTACGCCAACAGAGGTTGATGACTTTGACAAGACCATCATGCCTACACGCCCATCACCAAGTCCAGCCCCGCCATCTCCGAGACCGGTCGCCGATTTTGAAATCAGGGCCCCAGAACCCGAACGACGAGACCCAAGCCCGCCGGCTCTGTGCATGCGGGAATCAAGCGTCCGCCCTCATACATCGTCGACGCACTATTCGGTCCAGTCCACGACCATGACGACTAAAGTACCTTTACGCGAGGAAACCACCGACCCTAGTCTGGCGAAGCGCATTATGGCCCTTCAGAGGACACCATCGAGCGGATCATCTTCATCGTCGTCTTCGAACTCATCGCTGACCAACGGCAATGGAAAGCGGGGACGCGACACCAGTGGTCCATCATTCGATGTGAACAACCCGGCCCTGACTCCGACGATGACCCGTGAGCAGGCGCTGGCACAAATCAGGGAGCGCAGAGGACGGGCACGTAGCGCTATGGCAGGTGCCATAACACCCAAAAAGCAACAGCTGCCCTTGGGCGAAAGAAGGGATGTTAGCGCACCTGTAGGCCGTGTGGGTGTCGGAAGCAGTGCTGCCAACAGCATCAGGAAGAGACCCAGGACGTGAACCGAAATCTGTTCTTCTCACAAATCGGCAGGTTTTCCGCCTTGAAACTATAAAATATCTCAACAAACAGCGCACCCCGTATACAACATACTGGGGATTTGTCCCTTTGTCCACCTTGGGTTTACAGACATATTCGACTGCAGCGCCCACTCTGCACACATGCAAATATAAGGAGGTACAAAGTTGTACGAATATCCTGATTTAGCTTTGGTTTTTGATTTTTGGGGGCGTTTTGGGAACGGCACGAGGTTGGGCAGGGGAAAACGGCCAGAGAAAGGTCTACGCCTTTTTTTTTCTTTTCATGAAACCTTCTCATACCCATTCCGTCTCTGTTCTTTTCGCGGCTTTGTTTCGGAGTTTTGATACAAATCCCAGCTTTGTGTATTGCCACTCTCACACGCTTATTAAAGAGCCGCATTTAATCGCTCAAGACATGTTTGTTTTCAGTTTAATTTGATGGAATATAATTAAAACTGGCTTTCGATACGATACGATACTGAGATATGCATCATGAAATTAGTTTCTTTGTGCCTTCTTCTCACTCCTCTCCAGGGACCTTGATCCCACATGAAAGAAAATTCTCAGTCAAAGAAATTCTGCCATGGAATTACTCGAGTGCTCCGATGAAAATGCTTCCAGCTTGACCGCGACGAACAGACACTCGAGGGTGCCGTGCAGACAGCGCGTCCGCAACCGCCATTGCCCGGTCCGGATGACCCAGCCAGCCGTCTCGATTCCGGGGCGCTGCCTAGAGGCAACCGTCTTTCTCCTCTTGCGGGCTGGCCCATCCGTGCCCACCGTCAGTGCGTCGACGTCAATGTCCGCCAGGTCATCGGCGTCCCGGTGGCCAGTGAAGGGCTTCCCGTCTAGCGTTATCGCCGCGTCCTTGTCTATGATGGCGACAAGCTGATCCGCCTGTACCACCGAGACCTTGAGTAGCGAGCCAACAACATCAAAGAGGCGAGCGACTCGTTTCTTGGCGTCTAGGAAGAACTCCAACTGCGCCGTGTAGACCGTGGAGTCGGGCAAGGGGGCAAAGTCGTCCCGTAAGATGATTTCCAGTGGTCCCACCCGCGAGGCGTTACCCCCGATCTGCAGGACCAGTTCGGCGGGCTTGTCGCCCAAGTACGGACGCGCATAATTTACCCAGCCGTGAGACGGAGCCGAATCTACGGCAGATGGTGGTTCGGGGTAGACGCTGATGCCGGATTTGTAGATGTCCTCGACGCGGAGTAGGATTTGGTGACGGGCTCGGAGCTGATTGTATGAGGCGCAGTGGGAGATAAGACGCTGCTCGAGTCCCTTAAAGTTGAAGTACCTCACGTCGCGGAGGAGAGTCTGTCGGTGCGTCTCGTCGCGGACGTTAACGGGATTGCCACGTAGCAGGTGGAGTATCTCTTCAAAGGTGTCCGCAGAGCGGTGGGGGACGGAGGGGGGCAGGATTGAGGGCGGGCGGATGAGGTCTCTGCGGTCCAGGCCCGGGAAAAGGTCGTCCGGGGAGGAGAAGAAGATGGCAAAGCCTAGGGTGAAAAAGTTGGGAGAGTTCCCGGGGTCCTTGAAGAGATCGCGTGGGATTTGGAACTCTCGGTGGCCGATGGTCATAAATATGGGCTCTTCGTAGAGTTGTGATATCAACTTGGGGACTTTTGATAGTGGTCTTGCGTGTCAGCAAAGCTCTCTCACTAATTTCGCCTCTACGAGTTCCAAATCCACAGGGGCTTACGAGAGTAGAACTGGGCATCAGCAAATAGCCGTACAAAGTGTGTGGCATCCCGAGGATGAACGTGATAGCCTTGTAGATGCAGAGCAATGTCCTGAAAAGTCATGGGATCCCGATCAATATAGAGGGTGCGGATAGACGAGCAAACGTCGTCTCCATTTTCTTCTGCCGCTTTCATTTGGCATAAAAAATATTGAGAGAAATATGATGGAGCTACAAGCAGGGATTTCGTCAGTATTATGGGTTCGCACAAACTTGAAGGCATCTACGATTAGATGTCTTACCGTCTGATGATAGTGACGCCCCAGAGAGCTTGAACAATTTGGAGCCGATCTGGATGGGAAAGACGCGCTCATGAGGCAGAATTCTAGGGATCTTGCTCATGAGTTTGAGGTCCCGCTTAAGCTCACCCGCCGGACCGGAATGATGCGCTGCACTATCACCACGATCGGCAGCCATGAAGGCCGCTGGGATGCTGTTTCGGTCTTCTGAGAACATGGCGCAACGGGGCGGCGCGACAAAAGGCAAGCCGGGCGACCTTAAAGTCTACTGGGGCTGCTACCCCTTGTCGTTGACCTACTCCGGAATACGCTATACTGCAACCGCTTCAGAAGAAATTCGATCCTCTCTGATGAGATGCGTCCGAGCACGCGAGTGCTAGCAGGGAAATTGTGAGATGCGGACGGCCTAGTGGTGCCTGTGGGTTTGATGCCAACTAACCATACGCTGTCGGCTCGAGTGTATGCTTAATCGTCCTAAATATTTTTGGCCTGTCGTCGTGCCTCTCCACAAGATATGTTTTGTTATTGCCCACCACCCTTGAGCGGGTTTCTGGTACCAGACAGAGACTAGATGGATCTGTGCCTAAGTCTTAGACCCAGTCTATCTTTTTGTTAGAAAGTCAGTATTGCTTTGCATCAATGGGACGAGACCAAACCCATCTCAAAGTGCCGCGACTGCGAGACAATTTCCGACGAACAAAAGATTTGACCTGGTCTACATCACCTTACCTCAGTTGCCTGACTGTCCAGAGCTACGAAGTAGCCCATGTCAAATCTGTAGCCCGTGCCTTTATTCTCCCAAGTCGTTGCAGATGATTTCTGCAACCACCCGAACGGGTTTGTATCGTTAGAACCCCCGGTATGCGCTAGGCTCAACGGACTGGCAGGGGCAGCTGGTTCCCATGGCCCGTCAGAAGACTCGGATTCTCGGGTGCACCTAAACTAGGGGATCAAGAAGTAATGTGCAAACCGGCAAGACATGCATGCAGATGCAACAAATATTTTCTGGACAAATCTTGCACACGGAGCATGCGAACATGCGCAGTAATTAAGTAGGTAGGTAGTTGTACGAAGTACAAAGCCAAAGACTGCGGGTGGTGCAAGGTTAATGGTCGCTTATCAATGTAGGTTCCATTCGGTTGCATTCACTGTACCAGTACAATTTGATTTCACGGGTCCCGCAGCGGTCTATTGATCAGCACCACTCGAGCCGGCTACCCTGGCAGGCACGGATTGCTCAGCGTGCCCTGCAGAGAGCTTGACGAACTCGGTCCAGTCCCGTCGCTCCCACCACCTGCCACCCGCACCCCTGTCGGTCCGGGTGGATCCATTTGTTTATTGCTACAGGCCATAACGACCCTGTCGACCAATCCTAGGTCCCTTTGACGTCCAACGCAAATTCCGTTCCCCCCACCTCAACTTTTGGTATTCGTATGTTGTCGACTGGGGACAATTTCCCTAACTCCTAAAGTACTACGCCAGCTGGACAATTTGCCTCAGTTTGTGTTCCTTTTTTTTTTTTGTTTGCTCTTGAGGCTTTTGCCAAAACCATCATCCGCCATAGAAGATTCGACTTGAAGAGTGCTTGTAAACTTCGCCGTCCAAAGTAAAACGCCGTCAAGATGCGCGAGATTATCAGCATCAACGGTAAGCGCGTCTCCAAACAAAACTCACAAGACTCTTCACCGCATCAACCCCGAACACGCCACTCGAGCAATACAGTCAACATAACATGAACTAACGCTGCCTGTCTTCTAAATGTAGTCGGTCAGGCTGGTTGCCAGATTGCCAACTCTTGCTGGGAGGTGAGCACACACATACGACAGAAACTTGTTGCCGGAGCACCACAGCGCCTGGAAGGAGCACCACAGCGCCTGGAAGCCATAACGCAACCCTTAGAAGTCCAAAGGTTGGTGGCTGACATAAACTCGACGATAGCTCTACTGCCTCGAGCACGGCATCAAGGTAAGCTGATAACCCATGAGCAAAGCTACGTTCCCCTCATTCTAACAGCTTCGTTTTTCTTCCAGCCCGATGGTTTCCTTACCGATGAGCGCAAGGCCGCCGATCCCGACCACGGTTTCAGCACCTTCTTCTCCGAGACTGGTACGATACATTTGCTATATCTCGTAGTGGCCGACAAGAACACCTTTTGCGCCTTTGATATCCTCCTTTTTGCCGTTCACATGTACTAAACAGGCTGCATATGTGCTATCACAGGCCAGGGCAAGTATGTCCCACGTACCATTTACTGCGATTTGGAGCCCAATGTCGTCGACGAGGTCCGCACCGGTACCTACCGTAGCCTGTTCCACCCCGAGCAGATGATTACCGGCAAGGAGGACGCGTCGAACAACTACGCCCGTGGTCACTACACCGTCGGCAAGGAGTTGATCGACCAGGTGCTGGATAAGGTTCGCCGCGTTGCCGATAGCTGCTCTGGTCTCCAGGGCTTCTTGGTCTTCCACTCGTTCGGTGGTGGTACCGGATCCGGCTTTGGCTCTCTCCTTATGGAGCGTCTGTCGGTCGACTATGGAAAGAAGAGCAAGCTGGAGTTCTGTGTCTACCCGGCCCCCCAGACCGCCACCTCCGTTGTTGAGCCTTACAACTCGATCCTTACTACCCACACCACATTGGAGCACTCTGACTGCTCTTTCATGGTCGACAACGAGGCTATTTACGATATTTGCCGCCGAAGCCTCGGTCTTGAGAGGCCCAACTATGAAAACCTGAACCGCTTGATCGCTCAGGGTAAGATTTCATGGTGGATACCTTGAGCTCGCGTGCTTTGGATTTGGATGCTAATCAGCCGTGCCATGAATAGTCGTTTCCTCAATCACCGCCTCGCTCCGGTTCGACGGCTCCCTTAACGTCGACTTGAACGAGTTCCAGACCAACCTGGTGCCTTACCCCCGCATCCACTTCCCTCTGGTCGCCTACTCCCCGATTGTCTCGGCTGCTCGTGCTGCTCACGAGGCCAACTCGGTTCAGGAGATCACCATGTCTTGCTTCGAGCCAAACAACCAGATGGTTAAATGTGACCCTCGCAACGGAAAGTACATGGCCACGTGCTTGCTGTTCCGTGGTGATGTTGTTCCTAAGGACGCACATGCAGCTGTTGCCATGCTGAAGACCAAGCGTAGCATCCAGTTCGTCGACTGGTGCCCTACTGGCTTCAAGCTTGGTATCTGCTTCGAGCCTCCTCAACAGGTCCCTAACGGTGATCTTGCCAAGGTCAACCGCGCTGTGTAAGTTGAACCCTTGGTGTTTATCGTGATTCACGCCGGACTTTTTTAGCAACCTTGCCTAACTTGTTCACAGCTGCGTTCTCTCCAACACGACCGCCATCGCCGATGCTTGGTCAGCCTTGTCCAACAAGTTCGACCTCATGTACTCGAAGCGTGCGTTCGTCCACTGGTATGTGGGTGAGGGCATGGAGGAGGGAGAGTTCTCTGAGGCTCGTGAGGATCTCGCTGCTCTCGAGCGCGATTACGAGGAGGTTGCTACAGACTCTCTTGGTGATGAGGAGGGTATTGAGGCGGAGTACTAGACAAGCGGTGGTCCCGTTTTGTTCATGCTTCTGTTACAAAAGGCACGAGGTAGACGACCAGGACTCTGGATGGACTGGATGGATGCCACCTGCCAAAGAGGCCAGCATACCCTTTTGATACAGCAAATGTCAAGTGTAATTCTTCGGAGACAGCAACTCCTGACCACTCCTGGAGAGTTTTAAGAAGTCTTCGGGATGTAGAAGACTGTCGTCTCTTTCGAAGAGGCGTTAGTCGTATTTTATTTGGTTTGGTGCAACATAATAGCTCGTTTTAATAAAGATACCTGTTGGGGTTGACACTATTTTGTTTTTCAGGTCAACGTCGTGGGATTGTTTGTGTCCGTCCCATGCTGGAGCGCACAGGTATTCTGGTACCTGTCCATGGGTAAGGTGCGTGAAGTGGCTGAAGTGTAGAGGTGGCAGACGGTCGCCTGTCAAGCCTGTATGTGCATGGATAAGTCACTCGTTTGATGTCTGCTCCGTTGATGTTGATTGGACGGTGGAGCCGGTACTAGGGGTTGGCACTAGACTAAGCCAGAACCAGCTAATTAACTTCCACCCGCCTCGGCCGGCCTCCACGCGTCTGATTCTACAGTACAGTACAGGTCCTTGAGTACCTACTGCGTACTACGTAAGGTATGAATTAATTGCAAGGGTGCTGAATTGGTCAAGCAACTTCATAGGCGGATTCCCCGGTCCACAATGTTGTTTCCTCCCAGCAACGTCCTTGTCCTTCCCCAGCCATCTCATCCCACTTTGGAGATTCAACGGCAAAGTCTCAAACTCCTAATAATCTACTTTACAGACTGTCTATCGCATTCCTCAGCCACTGTTCTCTGCATACTTATTGGTTTCGTATTCGCCGGAGCGCAGAGCGTGTACTGCTCACCTGCTTACGAAAGAACAGCGGGAGAGAGAGAGAGAGAGCGAGGTCCTTGCTACCCGAGAACGCTTCGTTCCATCTGTGCCGAGCCGAGCCCAACCTTGCACGCTCCGTTTCGCTCGGTCAACGCCCAGGCACGACTGCATAAACCGTCAACATGGCAGAGTCTGGCGCCGAAGCAGGTGAGAAATGGGAGGCATAGTTACTTTGCTACTAGACTAAACCAAGCTGACCTTTGGTCGTGATTGAAATCTTTACAGGTGCGCCAAACTTAAACCTGACACCAGACGAGAAACGATACTACGGACAGTTGTTCCGACAGGCCGACACCGATGGGGTGGGTGTCGTAACTGGCGATGTTGCAGTCAAGTTCTTCGACAAGACCAGGCTTGAGTCTCGTATCCTCGGAGAGGTCAGTAGGAACGCGCCCATCAAGGCGATCATGACGTTGCAAAACCACCATGGTCGTCGAGCTTGTCGTTTGCTAATCCACTTCCATCCAACACACAGATCTGGCAGATAGCGGATCAAGAAAACAGAGGCTTTCTCACCCCGGCTGGCTTTGGCATCGTCCTACGTCTGATCGGCCACGCGCAGGCTGGCCGCGAGCCTACACCCGAGGTCGCTTTACAGCCTGGCCCTCTGCCTCGCTTCGATGGCATCAACATACCCGGTCTGGCACCCCAAACCAGCGGGTCTGGCCCTGGTCCGGCTGCGATGCCTCTTCAGGCCCAGGGCACCGGTGTCCGAATCCCGCCCTTGACACCCGAAAAGGCCGCCCAATATGCTGGCCTTTTCGAGCAGCAGAACTTAGCCCCCGGGAACATGCTCCCAGGTGACCAGGCCCGCCAGATCTTTGAAAGGTCCGGCTTGCCTACCGAGGTCCTCGGACGCATATGGCAGTTGGCCGATACAGAACAGCGGGGCGCACTGGTGCAGACCGAGTTCATTATTGCCATGCATCTCCTGGCCTCTACTAAGCAAGGCCAACTACGTGGACTGCCCAATGTTGTGTCCGCTGGTCTCTATGAGGCTGCAACACGCCGCCCGACCGGGATTCCGGGTCAAAGAAGCCCTACTTCGGGGGTGCCTCCCATTCCCGCGATTCCCAGGCAGTTGAGTGGACAGTCCCAGATGAGAACCGGGAGCCCGCTTGGAAGGTCACAGACAGGACCTGGGAGCGACTGGCTCATAACCGCAGCAGATAAAGGTCGGTTCGATCAGGAGTATGTCAAGCTTGATGCGGGCAACAAAGGGTTTATCACTGGAGAGGAAGCCGTGCCTTTCTTCAGCCAGTCCAATCTACCAGAGGATACGCTTGCACAGATCTGGGATCTGGCAGATATTAACTCAGCTGGCAGGCTCACGCGTGATGAGTTTGCAATTGCCATGTACCTCATCCGACAACAGCGCACCAACCGCAACGGTGCCAACACGCTACCGGCTACTCTCCCTCCCAACCTCATCCCACCCAGTATGCGAGGGCAGGCCAGACCGCCTACAGCTAACGCAGCCCACTCAGCTTTTGATGCGCCTGCTCCACCGCCGCCGCTGCCGCCTGCTCAGCCTAAATCTGCTTTGGATGATCTCTTCGGCCTGGACACCCCTCCTGTGCCAGCTGCACCTCTACAGAAGCCGATCGCAACAGGAGGCTCCAACGATCCTTTTGGCAGCAACGCAAGCCCAGCATCTGCCTCGCCTGCCAAACAGTCCCCCACTGTTCCCACCTTTGCTCCGTTTGTCCCGTCCTCCTCGTTCGGCCGTACTCTCACCGCGCAAACAACGGGCGCCTCCAACAGCTCCGCCGGCGCGTTTCCCAAGCCAGCTCCGGTCCAACAGCCGCAGCATTCTGGGACCTTTGATGACGACTTGCTGGGCGACAATGACGAAGGCAGCAAGAATGTTAGCAACGACTCGGCCGAGCTTGCAAACCTATCGAATCAGATTAGCTCCTTGAGCAAACATATGCAGGAGGTTCAAGGTCAGCGAACTACTACGCAGAACGAGCTGAATCAGTCGGCTGCGCAAAAGAAGAACTTTGAACAGCGCCTCGCTCAACTACGTGCCCTGTACGAGAAGGAAGCAAAGGACGTGCGGGCACTGGAGGATCAGCTCAACGCTTCTCGCAGTGAGACCAAGAAACTGCAAACTGAGATGGCCATGCTTGAAGGCACATATCAAGACCTTCAGAACCAGCATCGCCAGGTTGCCACTGCGCTGCAAGCGGATCAGCAGGAAAATGCCAACTTGAAGGATCGCATTCGGGCCGTCAATGCTGAGGTGGCCCAACTGAAGCCGCTGATCGAGAAGCTCAAATTGGAGGCGCGACAGCAGAAAGGGTTGGTTGCTATCAACAAAAAACAGCTGGCCACAAACGAGTCGGAGCGTGACAAACTCAAGTCAGAGATGGACGACTTTTCCAAGGGAACCGGAGAACTCAGCAGACAAAACACCGGCGCAGCCGCCCAGGTGGCTAGCCCGGCCGTCTCGACAACGAGTGTCAACAATCCGTTCTTCAGGAGAACTGGCAGCACAGACATCATGGGTGCCTTTGCGTCGCCACCTGCGAAGCCATCGAGCAACGACAAGTCGTTTGATGATGTCTTTGGCCCGTCTTTCGGCTCCGCGTCCAACACTCCGCCTCCCACTACCGCCTTCCTAGCGGCGCAGAACACGGGCGCTTCTACTGGCAGTGCGGCGTCTTTTGCGACGCCTGCCACCTCGAACACCCCCAACTTGAGCCGGCAACCCACCCTAACGACGGGTGAACCCCCTGCGCCGCCTGAGTCCCGGCAGATGAATTCCAGCTTCCTTCCATTCGGAGAGACGGAGTCGTTGTCATCGTCCCGTCAGGTATCTCCGCCTGCGAGCAGGATGGGTCAAGCAGATCTGCCACCATCTGATTCTGTCCAGAAACAGCCAACCGCCCCGCTGCAGTCCACTAACACGGGTCTCAGCGCGGCGTCAGGATCTCATGTGAGTATTAGATAGTAGCGAGGTGACTGCTTATTCTCACGGCGCTGGAAGTACTGACAAAATACAGGGCGATGTTCCTGGCACCACCTCACCAACTCCTCGTGCGGTTACTCACTCGCACTCCGACAGCGTCGGTGACCCCTTTTCCTCTGTCGATCAGGCCAAAGCCAAGGACGATTTCGAATCTGCTTTTGCAAGCTTCAAGAATGCACACACGAAGCCGGCTGCAGCAGGAGCATCCGCATTTGACATGCCATCTTCGTCCACTGGCGGATCTGAAGGGAAAGAACCGACGGTGGCTGCTTTCGCCTCCGAATTTCCGCCCATCTCGGAGCTGGAACGTGATGACGATTCCGACTCTGAAAGTGACAGAGATGGATTCGATGATGACTTCGCGCCGACATCTCCGAAACCCGCAACGGAAACGAATACGATTGGCGTCGCCTCCTCCGAGGACATCAAGCCGACATCCCCATCCACTGCACATTCAGGGGCTGATGGCGCTTCGAGGTACGATTCGATGCTATAGCCCATAGCGTGTGTATTTGCGTTTCAGACTTGTCAATGCCTCGGTGATGCATGAGTAGTTGTGGCGAAGTAGAAGGTGCTGACACTGAATGTAACTATAGCAATGTTGCAACGACACCGGCTGCCGCCACTTCATCTTCCTCTGTGAACACGGCGATGCCGCCTACCTCGGGTAACGCGGCGTCTGTCGCCGCTCCTACAGCCACAGGTTCCTTGGGTTCAGCAGGGCCGAGCGGGCCGCCACCCACTGCTCCGCCGCCTCTGCCGGAAAAGAAGTCTTTTGACGATCTTGATGATGACTTTGAGGGATTGGAGGACGCCCAAGAGGGCTCAGCAGCCGATGAAGACTTTGCCAACATTTCTCGCTCGGCTTTGGACGACTTTAATCCCGTATTTGACGACTCATCGCCCCCAAGGAGCCACGGAACCAAGAGCGATCTCTCCAAGGATCCCACTATTGGTACCGGAGCGCCAAACTTGGGAGCTGAGACGAGCAGTTTTGACTTTGTAAGCGGCAGCAGCGCTTCACTTGGTAGCTCAAGTGCGCAACCCGCCTCGACAGGCCCGCCGGCTCCGGCCAAAGTTCCGGCTCCGGGCGCAGCTGCTGAAGGTAGCACTGGAAATGACAACCATGACTGGGATGCCCTTTTTGCCGATCTTGATGGGCCAGCCGCTGGCAATACCGGCACTGTAGCCCCGGCCGCCACAGAGAATTCGACTTCCGCAAAGTCGCCTACTGCCGCGCCATCACGGCCGGCTGAAGTGAGCCGGCTGATGACTGAGGAAGGAGTGCATGATGACCCAATCCTCAAGAACCTGACCAGCATGGGGTACTCTCGTAAAGATGCCGTGGCCGCGCTCGAGAAGTACGATTACAATCTCGAGAGGGTAAGTGTCCAATTTTTACAAATTTCAGATATCATACCTCATACAAATGGATTTGCACATGGCTTTGACTAACTATCGTGCAATAGGCTGCCAACTACCTCGCAAGTCATTCCTGATCGAGGGATATATCAGTCAACTCATTTCCTTTCAAATCCATCCTGCATAGCCATTTCCTCGGCATTACAAACCCGAGTTCTTATTGCTTCGCCTACTGTTACATATGCAAATCACAGTGCCGTTCATCAAAGTTCATAGAAAAGAGGTGGTCGCTTCGCCGCGTCCAAGCCCGTCTTTGTGGTGGGGTTGTTTGATAGTTAAATTTTGTAATGATACCTCGAGGAAGCATTGATTAAGCTGGATATAGTTCTTTTTTCTTGACTTGTGTTTCGTTCGGTCCTACATCCAATTTGAACCATAGCCTACCTGCCTACCTACCTAACCTACCTAGGCAGCCATGTTCCGTGATGGAACCTTGGTTTGGGTCTGGCCGCTCTAGTAGTCATGCCAGGTATTGATTGCCGACAACAACTGACGTTCGGCTTCGATCAGGATCCCCCAGATTCTATCTCGTAAAAAGTGACTAAAACGCCCAGTCCCAGCGGTGGGCAATGCAAGGGGCAGGGCGACGACCAGGCAGTGACATAATGTGGGGCTAAAATGGCAGATCGGTGAATTTGGCCAATCAAATGCTTGATTGAGTGAGTTTCGTCGGCTGGCGGGAAGGCAGTGCGTGAACTATTTTGGCTACAAGTGTCCTCTTCCAAAGTGGGTGTGGGTGAGCTATCAAAGGTTGGAGTGACCAAAGCCAGATATTTCCGTTTGCGCGCTGCATACCTAGGTTTTTTGTTTTCCCCATCCTTCTTCTAGAGGCCACATTACACCCCGGCCTTTTGTCGTGATATATGACGCTGTGCTTTCCTATATCTCGTTCGTTCCTTTCTTCTTCCCTTCTTCATGACAATATACCCCACGTTGCAGTTACATGATCTATAGGCTAGGCCAGTAGCCACTTTCTTTGGCTTGTACCCAGCCTATCCCGCAACCTACCCACTGCCTACCTTAGGTACCTACCTAGGTAACCACCTATTTCAAGACGCCATACCAAAGCTACCTGCATAGATATCACCTCCAACCTTGGTCGACCTCGGGCACAACACAGACGAGCATAGCAATCTATCCCGCGACGGGTGCTGTCGCCATGGCGAAACTAGCCATGTCGCCTCTTATAAAGCTACTTTGTTCTTTGTTTCTATTCTCCTCTAATGTCCTCGCCATCTCGGCCGTTATAGGCATCGACCTGGGTACTGAGTATCTCAAGGCTTCACTTGTAAAGCCGGGAATCCCCCTCGACATTGTCTTGACCAAGGATTCGCGGCGCAAAGAAATATCGGCGGTCGTCTTCAAGCCACCACGAAATGGACCAAAGACTGGAGAATACCCCGAGCGTGCCTATGGCTCCGACGCCATGGCCCTCGCCCCGCGCTTCCCTGGCGACGTCTACCCGAACCTGAAAGCCCTCCTGGGCCTACCAACCGACACCTCGATTGTTCTCGAGTACGCTGCCCGCCACCCCGCACTGCAGCTCGGCTCGCACAAGCTTCGGAAGACGGCCACTTTCAAGAGTGCGGGTGCTTTCAGCCCCGAAGAGGAGGCTTGGATGGTTGAGGAGCTTCTGGCCATGGAACTCCAGAGTGTACAAAAGAGCGCAGAGGAGATGGCCGGTTCGACAGTTCGCTCCGCCGTCATTACGGTTCCGCCCTTCTACACCCTCGAGGAGAGGCGCGCCACCGAGACCGCCGCCGAGCTCGCAGGCCTTCGAGTCCTGTCGCTCATCAGCGACGGTCTTGCCGTTGGGCTTCACTACGCCACTAGCAGAACCTTCCCCAACATCAACCAGGGAGCTAAGGCGGAGCACCACATGGTTTTCGACATGGGCGCCGGATCCACCACCGCCACGGTCCTCAAGATGCAGAGCCGGCAGGTCAAGGACATTGGCAAGTTCAACAAGACGGTCCAGGAAGTTCAGGTCATGGGCAGCGGTTGGGATCGTACCCTGGGTGGTGACGCTTTGAACTACCTGATCGTCGACGACATGATTGCCAAGTTCGCCGAGTCGCCGGCCGCCAAGAAGGCATCGGTCACAACCCAAGGCGTCAAGGCTCACGGGCGCGCCATTTCGAAGCTCACCAAGGAGGCCGAGCGTATAAGACATGTCCTTAGCGCCAACAGTAATACTGGCGCAAGCTTTGAGGGCCTCTATGAAGATGTCGACTTCAAGTACAAGATTGAGCGGGTTGACTTTGAGAAGATGGCTGAAGATCAGGTTGGCCGCGTCTCTGTCGCCGTGAAGACTGCCCTAGAGACGGCTGGTATTGATATTGCAGACCTCGACTCGGTAATCCTGGCCGGTGGTGCTACGCGCACCCCGTTCGTCCAGCAGGAGCTGGAGAAGCTTTTTGGCGCCGAGAAGCTTCGCGCCAACGTCAACGCCGATGAAGCCGCCGTATTTGGTGCTGGCTTCAGGGCGGCTGAGATCAGCCCCAGCTTCCGTGTCAAGGAGATCAGGGTCTCGGACGGTGTCTCGTACGCTTCGGGTATCAAGTACAACAACCACAAGGGCAAGCCGACCCAACAGCGTCTCTGGAGCGCTAGGTCGCATCTGGGTGGTCCGGCCAAGGAAATCACACTGCCGAACAAGGAAGATTTTGAAATTGAATTCTACCAGCAGGTCCCGCAACTCCCTCCTGCCACCGGCTCGGATATCGAAGCACCCACTGCCAAGCTTACTACCAAAAACCTGACGGCTTCCGTTGCCGAGTTGAAGGAGAAGTACTCGTGTGAGCCTAGCGACGTCCAGTTCAAGCTCAGCGTCAGATTGAGCGGCGAGAATGGCGAGGTCGATGTCACCAAGCTCACCGTCCAGTGCGAAACTGAGACTCAAGAGAAGAAGGGAGTTGTCGATGGTGTCAAGAACCTCTTTGGCTTTGGAAAAAAGGAAGACCAGAAGCCCCTCGGCGGCGAGAGCGCCGATGGATCCTCGTCCAGCTCAGCTTCATCCAAGAGCACCAAGTCCGCCAAGTCTCCGGCATCAACTACGAGTGGATCCGCCTCGGCCTCGGGATCCGTGGAGCCTAGCGTTCCCCAGAAGAAGCTCGTTGTGATTCCTGTGCAGTTCGAGCTTGTCAAGGATGGAATCCCTGAGCTTTCCAAGGCAGAGCTCAAGGCCTCAAAAGACCGTTTAAAGGCTTTCGAGGCCTCTGACAAGGCACGTCGCCAGCGCGAGGAAGCTCTCAACCAGCTCGAGGGCTTTACGTACAAGGTCAGAGATCTCCTCGAGAACGACGACTTCGTGAAGGCTTCTACGCCCGAGGAGCGGACAAAGCTCGAGAAACTTAGCAGCGCTGCGAGCGAGTGGATCTACGATGATGGCGCCGATGCCCCCAAGGCCGAGCTCAAGACGAGACTAAAGGAATTGACAGATATCGTTGACCCGATTCAACTGAGAATCGAGGAAACTAGGAAGCGACCTGAACTTGTCAAGGGACTGCAGGATGCGCTCAAGCAGACAGAGGAATTTGTCGAAAACATCAAGAAGAGTATCGCTGAGTACGATGCATTCAAGTCGGCCGAGGCTGCTTCATCCTCGTCCACCATTGAGTCGGCGGCGCCTGAGGCAAGTCCTAAGGATGAGTTCGCAGGTCTGGAAGATAATGAAGCCAAGGCAAGCAAGGACAAGGAGCCTAGCATGGAGGACCTGAACAAGGAGCGTGGTCCAGTCCCGCCGATGTACACACCCGATGATCTCACTGAGCTCGAGGAACTCAAGGCGAAAATTGTTCCATGGCTCGATGAGAAGCTCAAGGAGCAGTCCAAGCTTGCCGAGACGGCCGACCCAGTCCTTACCATCAAGGAACTGACTACGTGGCGTACCAAGCTGGACAAGGCCGGTATGGACTTGACGATGAAGGGCGTCAGGAACTTTGAGAAGAGGAAGAAGGAGGAGGACGCCAAGAAAAGGAAGGCGCAGAAGAAGGCGAGCGGTGCGAAGTCGGACAAGCCGGTTAAGATAGAGCTCGGCAAGGACGGCAAGATGCCGACGCAAGAGGAGCTGGAGGAGCTGCTGAAGCAGTATGCGCCGCCCGAGACAGAAGGTGACGACAAGAAGGCGGAGAAGAAGAGCGATGACACCAAGATCAAGCATGAGGAGTTATAATTTGCAGGAAAGGGGGCTTTCGTGCGGGGGAAAAAACTGACGATTCACATGCGAGACTTTTAGACGTTATGGATTTCAGTGGCGATATACAGATTTTAGCATGTAGAACAAGGAAAGATTCAAGGGCGAGCCGTTGTCACCGCCTCTGGTATGTTCTGACAAGCTCTCCCAGTATAATCGTCTATGCAGATGGTTTTTTTTTTACTTTTTTTTTTTTTCCAGCTTTGCAACGGTCGAGAAGTAGCAGAAAACCCAAGGGGACCGACCAAGGTAAGTAGAAAAAGCCTCACTGGTGCCACATTTGCAGGGAAGCCATAAGCCCTGCACCCTTCTACTCGTCACCTCGGCAGATAAGGACTATTGATGTACAAAGCGGAGGGAACATTGTTCCAGATAACACGTCATGCTGTGAATCCTGCCATTCAAAGGATTGCGGCAAGGCGCCAATGAGACGTAGTATGTTAAGGGTGGGCATGTAGGTACTTTGTTCC
TACGAGCGGTGATCTTGTTGGGCGAGAAGATGGTGCCGTTCTGGCCAACACGGACAGCGTGGACTTGCTGGGCATCGACACCAGTAAACATTGCCAGGGC
GGCGAGAGCGACGGTAGCGAACTGCATTTTGAAGTTTAAAATTGAACTTCTTCGGTTGACACCTTCGGAAAAAAAATAATAAGTAGTGGATGGTTCGTCG
AAAGACCGTGTTGTTTGCAAAAGAGGATAGAGTAGAAGGAAGCTGTCGATCGGCGGCTCGCGCGTCAAACAGTAAGGACTAGCCTTTGAAGAAAAAAATT
AAAATTTCAAAGATGAGCCGAAGAAAAAACGATGGATCTCTGGATGATGGAGACTGGGAAGGAAGATCAGAGCAAGAACACCTCAAAAGGAGGGAAGATG
GCATGAATATATGGGAACTTTGGGAAGAGCTAAGCCGGCTGCGCCAAGAATCACCAAATTAGAGACAGCCCCATCAGAGGCCCCCATGTCGGGCGCCGGG
CAGGGGTATGAAGACGGATGCTTGAAACATCAAGGTAATCCGTAGGGGTGTGGGTGTTTTGACCCGTCACCGCAGCCCTGTCTACTCCACCGTCTCCATC
GACGAGGAAGAGGGCACCCAAAGGTTGCTGTGCCGATATCCTAACCTAACCTAGCCGTAAAAGAAGTTGCTGAAGCGAGGAACAATAGAAAGAAAAAAGA
AAAAAAGGGGTGGATGTTTGTCCAGATGGAAATGGGCGTGACGTGTGTTGGGCTTTGGAACAGGCCGCTGCATACTAGTCTACCTAGTGATACAACTTCA
ATCAGGGTGAAAATCACCAATAAGATAAACACAACTATTCTCAAGTGGCATGCTCTCTCGGGGAGCTAAAAGCGATTGACATGGTGCTGTCAGTTGTACA
GGTAGGCAAGCGCAAACCAGTCGGTTTAGCGCCACTGCATTGAATTGATTCGACAGAAAGAAGGAAAGTGAGATAACATTGGGGGCATAGAGAGCCAGAA
TAAGACATGGATGTGACGGAATTTCAGGACACATGTCTGTTTGCCTGTCAAGTCTAGTTGGGAACGGAATTTCTCAGCCTCAAAGAGATCACCTACTTCG
TACACATCAACCTTCATGTATCACAACACACGAATGTTTTCGTCATGAGATACCCAATCAAACGCCAGTAGCCAGGAACAAGGCGTAGCATAGCCACAGG
CTGATTGGTATTGCAAGTATGAAGTGTACGTAGGCTTTGATATCGGGACTTGAGAGCGCCGTCCTGGCAAAGGCTTGGTTGGTGCGAGTTGAAGCTGGGG
AACCGGGACTTGGGAAATTCCGGGGTTGAGACGTTGTTTAGATTGCTTTTAGTAAGGTTACCTTACTCCTTAAAGTCTTTAAGCTCTTAGAGGATGAAAA
CCTTGAAAAGGTGGGGTCATGCCCCTCGACATGGTCCAGTCAATTGAGCTAACGAAAAAAAATTTGTTCCCAAGGGGTAAGGACAACCCTGAGGCGACCC
AGACTCCGAGGGGAAATGGGGCACGGATGTGCATCATGCGATGAGGATGAAACAAGGCTGACGCTCGACAACGTCTCACTTAGCTCCCACTATCCCGTAC
GACCTGTCGTGCCTACCCAGACGTCAAATCTGTGCTAACCCTTTCATATGGGCTTTTCACTCGCCACAGGAGCATGCATCCACAGCCCTTTGATTGACCA
AGGGCCATCGATGCATCTACGTAATAACAGGTTTACCTCTTGTCTGACTGCGAACGACTGACTATACTGTGACACGACCAGCATGAGCCCTTGAAATAAT
AATTAATATATGCAAATCAAAACCATGTGCCTAAACGACGTCATCTTGATTGAACGATACTGACTTGAAGTGAAAACACGGGCGGCAGACCAGGCACATC
GGGACTCGGGAACATGATGTGAAAGTACAGAAACAAAGCATCAAAAAGAAACAGCAAAAAAGAAAAAGAAAAAAAAAGAGATCGAGGGGCGCGGGCAGAC
TCCTTGTCTCAATTATTTCAAGCCACTTCCGCTTGCCGAGCGGATCACCAGATCCCGGCTTCTGTGTGCCGCAAGCAGTCACGAAGAAAAAAAAAGCTGA
GAATGTTTCTCTGTTTCTTATTGGTCGGCAACTGGGATTGGCTGATGATATATCTGGAAGATCTTGGAAACACAACGGCCTTTGTTTCCACATGGCGGTT
TGGTCATCAAGGGGCGTTACATGCATTGTTCTGTTTGGCCAGGTAGCTACCCTGGTATCACAGGCAGGCCATTAGAGGCAGCCAGTGATGACAGCTCCGC
AGACGAGCCACCTACGCTTTTAGATCTGGACGCTGGCTCCCTCCTGATATGCCACAACCATATCTCACCATCTGCCGGCGGCTATCCAGTATCAATAATG
GTTGACCAACTCGGACATGTCATCACCTGAGACGATCAGTGTGTTATACCCTTCAGCGAGAGCTGTTGGGCATCGTCTGGCACACAATTCTCGACCTCTT
TTTTGTACAGCGATTGATTCGTCCCCATTAATTCGGCTTCCCCCGCCGTCGACCTTCGAGCAAGGGACACGCATGCCTCGTACGATCCCAGCGGTCCCCA
GATACCAGCCTTGAAAATCCATAGAACTTCAAAATACCTTAAGCTCAGTTGCATAGCCGACAAGAGGCTGGATTGCGATCGACGCGTGTCAAGCGATCAA
GTCTTGGCATAGAAACTCCCGAGGATCACCTGGGCAAGCGAGCCGGCAGCCCTTGCACTGCCTCACGAGTCAGAATCCGGCCCAGTTGTCTGACAAAGCA
AAACAAGACGTGGTCCTCCAACGAATGCACAAGTGCATGAGATGCAGCAAGCGTGTCTATCTATATTCAAAGTAGGTATACAGTGTATGGGTGGATAACC
GATATGCGTAAATGAACATTTCAAGAGCTTAATGCTATTGGCCGTGGGCATATTGGATGGGACAGGTTCGAAAACACCCCACAGGACCCGTCAAAGATCC
GAGTAGCCGAACAACTGTTAAACTACCTATAGTAGATTATCACTTGGGTGACTACACTGAGGGAGCTTCATGTCTGTTTCTAAGCCAGTTGTACTGTCGA
GATTCTGTGACGTACCTGTGCTTTGTGATTCCCTTTCTCCTTCTTTCACCAGCCAACCCCAACCAACTAACAATCCTTTCACTGGTGCAGCTCTCATCTA
TTCTTCTTTTTTCCATTCACGCTATTCTGAATACCCGAGGGTGGGCCCAATCCGTCCTAATGGGTTGGCTGGAGCGGATCATGCCTGGTTGTTCATGGAG
CTGAAGAGACGTACGGTATGGTATCGCCAAAACTAAAGTTAGACCATGGCGAGCACATCATCAACAAGGCGCAATCCGAGTTCAAGCAGCAACACTCTAG
ACACAGACATGATCCATTTCTGCAACTCGGGGTGCAAAATCATCATAGACACTCCACTAGACTAATAATAGTACCGACCTACATAGTAGGCAAGGTAGTG
AGTGAGTGTATGCGTGCTTCACGTGACACAGACCCCCCACATCCACACAGGTCGCCGTTTCCACAGTGACGGGTTTCCTTGGAGTGGAGCTCCGCAGTAA
ACATTGCATTATTTGGCAAACCTGAAAATCACTATCGTTCGTGAGTGACCCTTACCCAAAAAAAGCGAGACCAGGCCACACTGCCACGCCACTTTCTTAC
ATTGATCGCATGCGCACGTCGTACTCCATTCTCCATTGACTTGTCTCTGCCAGGCCTATATCGTGCTGTGTTTTATCACCAAGTCAGCACCAAGGTTTCT
GGGAAAAATAGACATATTCATAATCCCCAACGGACAGTTACTAGAGGGCGGCAAACAAAACAAATCCCACCAAAGCAAATCCAGCGCCAGGCACCTGCCC
ACAAAGTACAACATTCCGCACCCTATGAGTATAGTCTTGCGACGATAACAATCATGGACCCGACATCGGGTTGCCCACCGTCGCCCTCACCCGGCACGCC
ACTCCAAACAGCCTCGGCAGATCGTGTTAATCACCAGCGCGAGCAGTCGCTAGCATCGCCGTTTCAGCAGTCTTTGACGAACACGCCTGGCCGTGACCAC
TCCCGCGAAAGCTCAGTCCATGATAAGATCAACCAGTTCAACAACCTTGCCGTACACTCCAAGCAGCTGGAACGCAAGACTGCCGATGCGGCACTCAAGC
GCGCCATGCTAGGTCGCGAGGAGGCGGAGGCCGAAATGCGCAGGCATCGCGATGAGGCGAAGCTGCTGCGCAAACAGGTAGACGAGGGCAAGGAGCGAGA
GAGGAGGGTCGGAGAGAGACTGGAGACTGTCATGGTACGCATATAACATACCTTGCCCACGAGCAGTAAATCCTTCCATCCACCAACAAACAATGTTTAC
TAACGCTCAGCGAATCATTGACAGGAAAACTATGGTCGCGCGAAAGAAACACACGCGCATACCCAGGCTCTCTGGGAGAAGGAGATTCGCCGCGCGCGCA
AGGAAACCTTCAAGTTGCAGAGCGTCATCGTCAAACTCCAGGAGGAGCTCAAGTCTGCACGCGCTGCAGCCAAGACAGCCGAGGAAAGCCTAGCCCAGGA
ATCCCAGAGAAGGGAGGACCGAGAGCAGGAGGCCTTTAGTGCTCGATACGGCATTGCTGAGGTTCAAGAGAAATTCGAAGAGGCACAAGGGCGCATCCAG
ATATTGGAACAGGAGTGCGATGTCATCAGGCAGGAACGTGATGCTTTCAAGACATTGGCGAAAACGGAGGAGGACGTCGCCCGAATCGCGGCAGAAGGTC
GGTTGCCACTCCCAAAGTCGAAACCAACAGAGGGTGAGGAGGAGGACGAGTTCACATCCCCTAAGAAAAAGAGGCAACGATTGTCATCTTCTCCACCACC
GGTTGAAATCAGAACATCTGAAGCCAACGAGGCTGAGCTGGAGGAGTTATCCTTCTTACTGCAGTTGGAGAGGCAGCGGGCCGATCGAGCGGAAGGCCAT
ATCGAGTATCTCAAGGCCGAGTGCCAGCTTCGCATGTGTCCATGCATGAAGTCGCGGCCTCGGTCGAGCATTCTCTCGCACAGGTCCCCTGCTAAACCCG
CCCTTGCGTCTCCCCAGAAGAAAAACCGCATCGAGCATCTCAAAATAAGATCGGGACCGAGGCGAAGCACCATTTTCGTACCGGAGGAGGGCGTCTTCCG
CACAGTGTCGCAAGAGGAGGCGGAGGCGCTAGAGGCGCCGTCGATTCCGGCCCCTGAGACCGAGGATGTCGCCGAGGCCACGGCAGAGCCTATTACTCCT
GACACTCCTGCTGCTCTGAAAAAGAGTCCAGAGGCTTACGCAAGAACGCCATCCCTGGACCCGCCGGCTTTCGCCATGCTTTCGGAGACTAGGGCGTCAC
TTCTCTCTCTCCTCGACGCGCCACATCGAGCAGAGCCACCCATGACATTTCATGTCCCTACCATCCCTGGTGTGATATTTGAGGAATCAGTTCAATCAGT
CGCCAAGAAATCCGTCATGACAATTGACTTGAACTCGCCTCCTGCGGAGGAGACCCGAACTGCTACGCCAACAGAGGTTGATGACTTTGACAAGACCATC
ATGCCTACACGCCCATCACCAAGTCCAGCCCCGCCATCTCCGAGACCGGTCGCCGATTTTGAAATCAGGGCCCCAGAACCCGAACGACGAGACCCAAGCC
CGCCGGCTCTGTGCATGCGGGAATCAAGCGTCCGCCCTCATACATCGTCGACGCACTATTCGGTCCAGTCCACGACCATGACGACTAAAGTACCTTTACG
CGAGGAAACCACCGACCCTAGTCTGGCGAAGCGCATTATGGCCCTTCAGAGGACACCATCGAGCGGATCATCTTCATCGTCGTCTTCGAACTCATCGCTG
ACCAACGGCAATGGAAAGCGGGGACGCGACACCAGTGGTCCATCATTCGATGTGAACAACCCGGCCCTGACTCCGACGATGACCCGTGAGCAGGCGCTGG
CACAAATCAGGGAGCGCAGAGGACGGGCACGTAGCGCTATGGCAGGTGCCATAACACCCAAAAAGCAACAGCTGCCCTTGGGCGAAAGAAGGGATGTTAG
CGCACCTGTAGGCCGTGTGGGTGTCGGAAGCAGTGCTGCCAACAGCATCAGGAAGAGACCCAGGACGTGAACCGAAATCTGTTCTTCTCACAAATCGGCA
GGTTTTCCGCCTTGAAACTATAAAATATCTCAACAAACAGCGCACCCCGTATACAACATACTGGGGATTTGTCCCTTTGTCCACCTTGGGTTTACAGACA
TATTCGACTGCAGCGCCCACTCTGCACACATGCAAATATAAGGAGGTACAAAGTTGTACGAATATCCTGATTTAGCTTTGGTTTTTGATTTTTGGGGGCG
TTTTGGGAACGGCACGAGGTTGGGCAGGGGAAAACGGCCAGAGAAAGGTCTACGCCTTTTTTTTTCTTTTCATGAAACCTTCTCATACCCATTCCGTCTC
TGTTCTTTTCGCGGCTTTGTTTCGGAGTTTTGATACAAATCCCAGCTTTGTGTATTGCCACTCTCACACGCTTATTAAAGAGCCGCATTTAATCGCTCAA
GACATGTTTGTTTTCAGTTTAATTTGATGGAATATAATTAAAACTGGCTTTCGATACGATACGATACTGAGATATGCATCATGAAATTAGTTTCTTTGTG
CCTTCTTCTCACTCCTCTCCAGGGACCTTGATCCCACATGAAAGAAAATTCTCAGTCAAAGAAATTCTGCCATGGAATTACTCGAGTGCTCCGATGAAAA
TGCTTCCAGCTTGACCGCGACGAACAGACACTCGAGGGTGCCGTGCAGACAGCGCGTCCGCAACCGCCATTGCCCGGTCCGGATGACCCAGCCAGCCGTC
TCGATTCCGGGGCGCTGCCTAGAGGCAACCGTCTTTCTCCTCTTGCGGGCTGGCCCATCCGTGCCCACCGTCAGTGCGTCGACGTCAATGTCCGCCAGGT
CATCGGCGTCCCGGTGGCCAGTGAAGGGCTTCCCGTCTAGCGTTATCGCCGCGTCCTTGTCTATGATGGCGACAAGCTGATCCGCCTGTACCACCGAGAC
CTTGAGTAGCGAGCCAACAACATCAAAGAGGCGAGCGACTCGTTTCTTGGCGTCTAGGAAGAACTCCAACTGCGCCGTGTAGACCGTGGAGTCGGGCAAG
GGGGCAAAGTCGTCCCGTAAGATGATTTCCAGTGGTCCCACCCGCGAGGCGTTACCCCCGATCTGCAGGACCAGTTCGGCGGGCTTGTCGCCCAAGTACG
GACGCGCATAATTTACCCAGCCGTGAGACGGAGCCGAATCTACGGCAGATGGTGGTTCGGGGTAGACGCTGATGCCGGATTTGTAGATGTCCTCGACGCG
GAGTAGGATTTGGTGACGGGCTCGGAGCTGATTGTATGAGGCGCAGTGGGAGATAAGACGCTGCTCGAGTCCCTTAAAGTTGAAGTACCTCACGTCGCGG
AGGAGAGTCTGTCGGTGCGTCTCGTCGCGGACGTTAACGGGATTGCCACGTAGCAGGTGGAGTATCTCTTCAAAGGTGTCCGCAGAGCGGTGGGGGACGG
AGGGGGGCAGGATTGAGGGCGGGCGGATGAGGTCTCTGCGGTCCAGGCCCGGGAAAAGGTCGTCCGGGGAGGAGAAGAAGATGGCAAAGCCTAGGGTGAA
AAAGTTGGGAGAGTTCCCGGGGTCCTTGAAGAGATCGCGTGGGATTTGGAACTCTCGGTGGCCGATGGTCATAAATATGGGCTCTTCGTAGAGTTGTGAT
ATCAACTTGGGGACTTTTGATAGTGGTCTTGCGTGTCAGCAAAGCTCTCTCACTAATTTCGCCTCTACGAGTTCCAAATCCACAGGGGCTTACGAGAGTA
GAACTGGGCATCAGCAAATAGCCGTACAAAGTGTGTGGCATCCCGAGGATGAACGTGATAGCCTTGTAGATGCAGAGCAATGTCCTGAAAAGTCATGGGA
TCCCGATCAATATAGAGGGTGCGGATAGACGAGCAAACGTCGTCTCCATTTTCTTCTGCCGCTTTCATTTGGCATAAAAAATATTGAGAGAAATATGATG
GAGCTACAAGCAGGGATTTCGTCAGTATTATGGGTTCGCACAAACTTGAAGGCATCTACGATTAGATGTCTTACCGTCTGATGATAGTGACGCCCCAGAG
AGCTTGAACAATTTGGAGCCGATCTGGATGGGAAAGACGCGCTCATGAGGCAGAATTCTAGGGATCTTGCTCATGAGTTTGAGGTCCCGCTTAAGCTCAC
CCGCCGGACCGGAATGATGCGCTGCACTATCACCACGATCGGCAGCCATGAAGGCCGCTGGGATGCTGTTTCGGTCTTCTGAGAACATGGCGCAACGGGG
CGGCGCGACAAAAGGCAAGCCGGGCGACCTTAAAGTCTACTGGGGCTGCTACCCCTTGTCGTTGACCTACTCCGGAATACGCTATACTGCAACCGCTTCA
GAAGAAATTCGATCCTCTCTGATGAGATGCGTCCGAGCACGCGAGTGCTAGCAGGGAAATTGTGAGATGCGGACGGCCTAGTGGTGCCTGTGGGTTTGAT
GCCAACTAACCATACGCTGTCGGCTCGAGTGTATGCTTAATCGTCCTAAATATTTTTGGCCTGTCGTCGTGCCTCTCCACAAGATATGTTTTGTTATTGC
CCACCACCCTTGAGCGGGTTTCTGGTACCAGACAGAGACTAGATGGATCTGTGCCTAAGTCTTAGACCCAGTCTATCTTTTTGTTAGAAAGTCAGTATTG
CTTTGCATCAATGGGACGAGACCAAACCCATCTCAAAGTGCCGCGACTGCGAGACAATTTCCGACGAACAAAAGATTTGACCTGGTCTACATCACCTTAC
CTCAGTTGCCTGACTGTCCAGAGCTACGAAGTAGCCCATGTCAAATCTGTAGCCCGTGCCTTTATTCTCCCAAGTCGTTGCAGATGATTTCTGCAACCAC
CCGAACGGGTTTGTATCGTTAGAACCCCCGGTATGCGCTAGGCTCAACGGACTGGCAGGGGCAGCTGGTTCCCATGGCCCGTCAGAAGACTCGGATTCTC
GGGTGCACCTAAACTAGGGGATCAAGAAGTAATGTGCAAACCGGCAAGACATGCATGCAGATGCAACAAATATTTTCTGGACAAATCTTGCACACGGAGC
ATGCGAACATGCGCAGTAATTAAGTAGGTAGGTAGTTGTACGAAGTACAAAGCCAAAGACTGCGGGTGGTGCAAGGTTAATGGTCGCTTATCAATGTAGG
TTCCATTCGGTTGCATTCACTGTACCAGTACAATTTGATTTCACGGGTCCCGCAGCGGTCTATTGATCAGCACCACTCGAGCCGGCTACCCTGGCAGGCA
CGGATTGCTCAGCGTGCCCTGCAGAGAGCTTGACGAACTCGGTCCAGTCCCGTCGCTCCCACCACCTGCCACCCGCACCCCTGTCGGTCCGGGTGGATCC
ATTTGTTTATTGCTACAGGCCATAACGACCCTGTCGACCAATCCTAGGTCCCTTTGACGTCCAACGCAAATTCCGTTCCCCCCACCTCAACTTTTGGTAT
TCGTATGTTGTCGACTGGGGACAATTTCCCTAACTCCTAAAGTACTACGCCAGCTGGACAATTTGCCTCAGTTTGTGTTCCTTTTTTTTTTTTGTTTGCT
CTTGAGGCTTTTGCCAAAACCATCATCCGCCATAGAAGATTCGACTTGAAGAGTGCTTGTAAACTTCGCCGTCCAAAGTAAAACGCCGTCAAGATGCGCG
AGATTATCAGCATCAACG
GTAAGCGCGTCTCCAAACAAAACTCACAAGACTCTTCACCGCATCAACCCCGAACACGCCACTCGAGCAATACAGTCAACAT
AACATGAACTAACGCTGCCTGTCTTCTAAATGTAG
TCGGTCAGGCTGGTTGCCAGATTGCCAACTCTTGCTGGGAGGTGAGCACACACATACGACAGAAA
CTTGTTGCCGGAGCACCACAGCGCCTGGAAGGAGCACCACAGCGCCTGGAAGCCATAACGCAACCCTTAGAAGTCCAAAGGTTGGTGGCTGACATAAACT
CGACGATAG
CTCTACTGCCTCGAGCACGGCATCAAGGTAAGCTGATAACCCATGAGCAAAGCTACGTTCCCCTCATTCTAACAGCTTCGTTTTTCTTCCA
G
CCCGATGGTTTCCTTACCGATGAGCGCAAGGCCGCCGATCCCGACCACGGTTTCAGCACCTTCTTCTCCGAGACTGGTACGATACATTTGCTATATCTC
GTAGTGGCCGACAAGAACACCTTTTGCGCCTTTGATATCCTCCTTTTTGCCGTTCACATGTACTAAACAGGCTGCATATGTGCTATCACAG
GCCAGGGCA
AGTATGTCCCACGTACCATTTACTGCGATTTGGAGCCCAATGTCGTCGACGAGGTCCGCACCGGTACCTACCGTAGCCTGTTCCACCCCGAGCAGATGAT
TACCGGCAAGGAGGACGCGTCGAACAACTACGCCCGTGGTCACTACACCGTCGGCAAGGAGTTGATCGACCAGGTGCTGGATAAGGTTCGCCGCGTTGCC
GATAGCTGCTCTGGTCTCCAGGGCTTCTTGGTCTTCCACTCGTTCGGTGGTGGTACCGGATCCGGCTTTGGCTCTCTCCTTATGGAGCGTCTGTCGGTCG
ACTATGGAAAGAAGAGCAAGCTGGAGTTCTGTGTCTACCCGGCCCCCCAGACCGCCACCTCCGTTGTTGAGCCTTACAACTCGATCCTTACTACCCACAC
CACATTGGAGCACTCTGACTGCTCTTTCATGGTCGACAACGAGGCTATTTACGATATTTGCCGCCGAAGCCTCGGTCTTGAGAGGCCCAACTATGAAAAC
CTGAACCGCTTGATCGCTCAGG
GTAAGATTTCATGGTGGATACCTTGAGCTCGCGTGCTTTGGATTTGGATGCTAATCAGCCGTGCCATGAATAGTCGTT
TCCTCAATCACCGCCTCGCTCCGGTTCGACGGCTCCCTTAACGTCGACTTGAACGAGTTCCAGACCAACCTGGTGCCTTACCCCCGCATCCACTTCCCTC
TGGTCGCCTACTCCCCGATTGTCTCGGCTGCTCGTGCTGCTCACGAGGCCAACTCGGTTCAGGAGATCACCATGTCTTGCTTCGAGCCAAACAACCAGAT
GGTTAAATGTGACCCTCGCAACGGAAAGTACATGGCCACGTGCTTGCTGTTCCGTGGTGATGTTGTTCCTAAGGACGCACATGCAGCTGTTGCCATGCTG
AAGACCAAGCGTAGCATCCAGTTCGTCGACTGGTGCCCTACTGGCTTCAAGCTTGGTATCTGCTTCGAGCCTCCTCAACAGGTCCCTAACGGTGATCTTG
CCAAGGTCAACCGCGCTGT
GTAAGTTGAACCCTTGGTGTTTATCGTGATTCACGCCGGACTTTTTTAGCAACCTTGCCTAACTTGTTCACAGCTGCGTTC
TCTCCAACACGACCGCCATCGCCGATGCTTGGTCAGCCTTGTCCAACAAGTTCGACCTCATGTACTCGAAGCGTGCGTTCGTCCACTGGTATGTGGGTGA
GGGCATGGAGGAGGGAGAGTTCTCTGAGGCTCGTGAGGATCTCGCTGCTCTCGAGCGCGATTACGAGGAGGTTGCTACAGACTCTCTTGGTGATGAGGAG
GGTATTGAGGCGGAGTACTAG
ACAAGCGGTGGTCCCGTTTTGTTCATGCTTCTGTTACAAAAGGCACGAGGTAGACGACCAGGACTCTGGATGGACTGGA
TGGATGCCACCTGCCAAAGAGGCCAGCATACCCTTTTGATACAGCAAATGTCAAGTGTAATTCTTCGGAGACAGCAACTCCTGACCACTCCTGGAGAGTT
TTAAGAAGTCTTCGGGATGTAGAAGACTGTCGTCTCTTTCGAAGAGGCGTTAGTCGTATTTTATTTGGTTTGGTGCAACATAATAGCTCGTTTTAATAAA
GATACCTGTTGGGGTTGACACTATTTTGTTTTTCAGGTCAACGTCGTGGGATTGTTTGTGTCCGTCCCATGCTGGAGCGCACAGGTATTCTGGTACCTGT
CCATGGGTAAGGTGCGTGAAGTGGCTGAAGTGTAGAGGTGGCAGACGGTCGCCTGTCAAGCCTGTATGTGCATGGATAAGTCACTCGTTTGATGTCTGCT
CCGTTGATGTTGATTGGACGGTGGAGCCGGTACTAGGGGTTGGCACTAGACTAAGCCAGAACCAGCTAATTAACTTCCACCCGCCTCGGCCGGCCTCCAC
GCGTCTGATTCTACAGTACAGTACAGGTCCTTGAGTACCTACTGCGTACTACGTAAGGTATGAATTAATTGCAAGGGTGCTGAATTGGTCAAGCAACTTC
ATAGGCGGATTCCCCGGTCCACAATGTTGTTTCCTCCCAGCAACGTCCTTGTCCTTCCCCAGCCATCTCATCCCACTTTGGAGATTCAACGGCAAAGTCT
CAAACTCCTAATAATCTACTTTACAGACTGTCTATCGCATTCCTCAGCCACTGTTCTCTGCATACTTATTGGTTTCGTATTCGCCGGAGCGCAGAGCGTG
TACTGCTCACCTGCTTACGAAAGAACAGCGGGAGAGAGAGAGAGAGAGCGAGGTCCTTGCTACCCGAGAACGCTTCGTTCCATCTGTGCCGAGCCGAGCC
CAACCTTGCACGCTCCGTTTCGCTCGGTCAACGCCCAGGCACGACTGCATAAACCGTCAACATGGCAGAGTCTGGCGCCGAAGCAGGTGAGAAATGGGAG
GCATAGTTACTTTGCTACTAGACTAAACCAAGCTGACCTTTGGTCGTGATTGAAATCTTTACAGGTGCGCCAAACTTAAACCTGACACCAGACGAGAAAC
GATACTACGGACAGTTGTTCCGACAGGCCGACACCGATGGGGTGGGTGTCGTAACTGGCGATGTTGCAGTCAAGTTCTTCGACAAGACCAGGCTTGAGTC
TCGTATCCTCGGAGAGGTCAGTAGGAACGCGCCCATCAAGGCGATCATGACGTTGCAAAACCACCATGGTCGTCGAGCTTGTCGTTTGCTAATCCACTTC
CATCCAACACACAGATCTGGCAGATAGCGGATCAAGAAAACAGAGGCTTTCTCACCCCGGCTGGCTTTGGCATCGTCCTACGTCTGATCGGCCACGCGCA
GGCTGGCCGCGAGCCTACACCCGAGGTCGCTTTACAGCCTGGCCCTCTGCCTCGCTTCGATGGCATCAACATACCCGGTCTGGCACCCCAAACCAGCGGG
TCTGGCCCTGGTCCGGCTGCGATGCCTCTTCAGGCCCAGGGCACCGGTGTCCGAATCCCGCCCTTGACACCCGAAAAGGCCGCCCAATATGCTGGCCTTT
TCGAGCAGCAGAACTTAGCCCCCGGGAACATGCTCCCAGGTGACCAGGCCCGCCAGATCTTTGAAAGGTCCGGCTTGCCTACCGAGGTCCTCGGACGCAT
ATGGCAGTTGGCCGATACAGAACAGCGGGGCGCACTGGTGCAGACCGAGTTCATTATTGCCATGCATCTCCTGGCCTCTACTAAGCAAGGCCAACTACGT
GGACTGCCCAATGTTGTGTCCGCTGGTCTCTATGAGGCTGCAACACGCCGCCCGACCGGGATTCCGGGTCAAAGAAGCCCTACTTCGGGGGTGCCTCCCA
TTCCCGCGATTCCCAGGCAGTTGAGTGGACAGTCCCAGATGAGAACCGGGAGCCCGCTTGGAAGGTCACAGACAGGACCTGGGAGCGACTGGCTCATAAC
CGCAGCAGATAAAGGTCGGTTCGATCAGGAGTATGTCAAGCTTGATGCGGGCAACAAAGGGTTTATCACTGGAGAGGAAGCCGTGCCTTTCTTCAGCCAG
TCCAATCTACCAGAGGATACGCTTGCACAGATCTGGGATCTGGCAGATATTAACTCAGCTGGCAGGCTCACGCGTGATGAGTTTGCAATTGCCATGTACC
TCATCCGACAACAGCGCACCAACCGCAACGGTGCCAACACGCTACCGGCTACTCTCCCTCCCAACCTCATCCCACCCAGTATGCGAGGGCAGGCCAGACC
GCCTACAGCTAACGCAGCCCACTCAGCTTTTGATGCGCCTGCTCCACCGCCGCCGCTGCCGCCTGCTCAGCCTAAATCTGCTTTGGATGATCTCTTCGGC
CTGGACACCCCTCCTGTGCCAGCTGCACCTCTACAGAAGCCGATCGCAACAGGAGGCTCCAACGATCCTTTTGGCAGCAACGCAAGCCCAGCATCTGCCT
CGCCTGCCAAACAGTCCCCCACTGTTCCCACCTTTGCTCCGTTTGTCCCGTCCTCCTCGTTCGGCCGTACTCTCACCGCGCAAACAACGGGCGCCTCCAA
CAGCTCCGCCGGCGCGTTTCCCAAGCCAGCTCCGGTCCAACAGCCGCAGCATTCTGGGACCTTTGATGACGACTTGCTGGGCGACAATGACGAAGGCAGC
AAGAATGTTAGCAACGACTCGGCCGAGCTTGCAAACCTATCGAATCAGATTAGCTCCTTGAGCAAACATATGCAGGAGGTTCAAGGTCAGCGAACTACTA
CGCAGAACGAGCTGAATCAGTCGGCTGCGCAAAAGAAGAACTTTGAACAGCGCCTCGCTCAACTACGTGCCCTGTACGAGAAGGAAGCAAAGGACGTGCG
GGCACTGGAGGATCAGCTCAACGCTTCTCGCAGTGAGACCAAGAAACTGCAAACTGAGATGGCCATGCTTGAAGGCACATATCAAGACCTTCAGAACCAG
CATCGCCAGGTTGCCACTGCGCTGCAAGCGGATCAGCAGGAAAATGCCAACTTGAAGGATCGCATTCGGGCCGTCAATGCTGAGGTGGCCCAACTGAAGC
CGCTGATCGAGAAGCTCAAATTGGAGGCGCGACAGCAGAAAGGGTTGGTTGCTATCAACAAAAAACAGCTGGCCACAAACGAGTCGGAGCGTGACAAACT
CAAGTCAGAGATGGACGACTTTTCCAAGGGAACCGGAGAACTCAGCAGACAAAACACCGGCGCAGCCGCCCAGGTGGCTAGCCCGGCCGTCTCGACAACG
AGTGTCAACAATCCGTTCTTCAGGAGAACTGGCAGCACAGACATCATGGGTGCCTTTGCGTCGCCACCTGCGAAGCCATCGAGCAACGACAAGTCGTTTG
ATGATGTCTTTGGCCCGTCTTTCGGCTCCGCGTCCAACACTCCGCCTCCCACTACCGCCTTCCTAGCGGCGCAGAACACGGGCGCTTCTACTGGCAGTGC
GGCGTCTTTTGCGACGCCTGCCACCTCGAACACCCCCAACTTGAGCCGGCAACCCACCCTAACGACGGGTGAACCCCCTGCGCCGCCTGAGTCCCGGCAG
ATGAATTCCAGCTTCCTTCCATTCGGAGAGACGGAGTCGTTGTCATCGTCCCGTCAGGTATCTCCGCCTGCGAGCAGGATGGGTCAAGCAGATCTGCCAC
CATCTGATTCTGTCCAGAAACAGCCAACCGCCCCGCTGCAGTCCACTAACACGGGTCTCAGCGCGGCGTCAGGATCTCATGTGAGTATTAGATAGTAGCG
AGGTGACTGCTTATTCTCACGGCGCTGGAAGTACTGACAAAATACAGGGCGATGTTCCTGGCACCACCTCACCAACTCCTCGTGCGGTTACTCACTCGCA
CTCCGACAGCGTCGGTGACCCCTTTTCCTCTGTCGATCAGGCCAAAGCCAAGGACGATTTCGAATCTGCTTTTGCAAGCTTCAAGAATGCACACACGAAG
CCGGCTGCAGCAGGAGCATCCGCATTTGACATGCCATCTTCGTCCACTGGCGGATCTGAAGGGAAAGAACCGACGGTGGCTGCTTTCGCCTCCGAATTTC
CGCCCATCTCGGAGCTGGAACGTGATGACGATTCCGACTCTGAAAGTGACAGAGATGGATTCGATGATGACTTCGCGCCGACATCTCCGAAACCCGCAAC
GGAAACGAATACGATTGGCGTCGCCTCCTCCGAGGACATCAAGCCGACATCCCCATCCACTGCACATTCAGGGGCTGATGGCGCTTCGAGGTACGATTCG
ATGCTATAGCCCATAGCGTGTGTATTTGCGTTTCAGACTTGTCAATGCCTCGGTGATGCATGAGTAGTTGTGGCGAAGTAGAAGGTGCTGACACTGAATG
TAACTATAGCAATGTTGCAACGACACCGGCTGCCGCCACTTCATCTTCCTCTGTGAACACGGCGATGCCGCCTACCTCGGGTAACGCGGCGTCTGTCGCC
GCTCCTACAGCCACAGGTTCCTTGGGTTCAGCAGGGCCGAGCGGGCCGCCACCCACTGCTCCGCCGCCTCTGCCGGAAAAGAAGTCTTTTGACGATCTTG
ATGATGACTTTGAGGGATTGGAGGACGCCCAAGAGGGCTCAGCAGCCGATGAAGACTTTGCCAACATTTCTCGCTCGGCTTTGGACGACTTTAATCCCGT
ATTTGACGACTCATCGCCCCCAAGGAGCCACGGAACCAAGAGCGATCTCTCCAAGGATCCCACTATTGGTACCGGAGCGCCAAACTTGGGAGCTGAGACG
AGCAGTTTTGACTTTGTAAGCGGCAGCAGCGCTTCACTTGGTAGCTCAAGTGCGCAACCCGCCTCGACAGGCCCGCCGGCTCCGGCCAAAGTTCCGGCTC
CGGGCGCAGCTGCTGAAGGTAGCACTGGAAATGACAACCATGACTGGGATGCCCTTTTTGCCGATCTTGATGGGCCAGCCGCTGGCAATACCGGCACTGT
AGCCCCGGCCGCCACAGAGAATTCGACTTCCGCAAAGTCGCCTACTGCCGCGCCATCACGGCCGGCTGAAGTGAGCCGGCTGATGACTGAGGAAGGAGTG
CATGATGACCCAATCCTCAAGAACCTGACCAGCATGGGGTACTCTCGTAAAGATGCCGTGGCCGCGCTCGAGAAGTACGATTACAATCTCGAGAGGGTAA
GTGTCCAATTTTTACAAATTTCAGATATCATACCTCATACAAATGGATTTGCACATGGCTTTGACTAACTATCGTGCAATAGGCTGCCAACTACCTCGCA
AGTCATTCCTGATCGAGGGATATATCAGTCAACTCATTTCCTTTCAAATCCATCCTGCATAGCCATTTCCTCGGCATTACAAACCCGAGTTCTTATTGCT
TCGCCTACTGTTACATATGCAAATCACAGTGCCGTTCATCAAAGTTCATAGAAAAGAGGTGGTCGCTTCGCCGCGTCCAAGCCCGTCTTTGTGGTGGGGT
TGTTTGATAGTTAAATTTTGTAATGATACCTCGAGGAAGCATTGATTAAGCTGGATATAGTTCTTTTTTCTTGACTTGTGTTTCGTTCGGTCCTACATCC
AATTTGAACCATAGCCTACCTGCCTACCTACCTAACCTACCTAGGCAGCCATGTTCCGTGATGGAACCTTGGTTTGGGTCTGGCCGCTCTAGTAGTCATG
CCAGGTATTGATTGCCGACAACAACTGACGTTCGGCTTCGATCAGGATCCCCCAGATTCTATCTCGTAAAAAGTGACTAAAACGCCCAGTCCCAGCGGTG
GGCAATGCAAGGGGCAGGGCGACGACCAGGCAGTGACATAATGTGGGGCTAAAATGGCAGATCGGTGAATTTGGCCAATCAAATGCTTGATTGAGTGAGT
TTCGTCGGCTGGCGGGAAGGCAGTGCGTGAACTATTTTGGCTACAAGTGTCCTCTTCCAAAGTGGGTGTGGGTGAGCTATCAAAGGTTGGAGTGACCAAA
GCCAGATATTTCCGTTTGCGCGCTGCATACCTAGGTTTTTTGTTTTCCCCATCCTTCTTCTAGAGGCCACATTACACCCCGGCCTTTTGTCGTGATATAT
GACGCTGTGCTTTCCTATATCTCGTTCGTTCCTTTCTTCTTCCCTTCTTCATGACAATATACCCCACGTTGCAGTTACATGATCTATAGGCTAGGCCAGT
AGCCACTTTCTTTGGCTTGTACCCAGCCTATCCCGCAACCTACCCACTGCCTACCTTAGGTACCTACCTAGGTAACCACCTATTTCAAGACGCCATACCA
AAGCTACCTGCATAGATATCACCTCCAACCTTGGTCGACCTCGGGCACAACACAGACGAGCATAGCAATCTATCCCGCGACGGGTGCTGTCGCCATGGCG
AAACTAGCCATGTCGCCTCTTATAAAGCTACTTTGTTCTTTGTTTCTATTCTCCTCTAATGTCCTCGCCATCTCGGCCGTTATAGGCATCGACCTGGGTA
CTGAGTATCTCAAGGCTTCACTTGTAAAGCCGGGAATCCCCCTCGACATTGTCTTGACCAAGGATTCGCGGCGCAAAGAAATATCGGCGGTCGTCTTCAA
GCCACCACGAAATGGACCAAAGACTGGAGAATACCCCGAGCGTGCCTATGGCTCCGACGCCATGGCCCTCGCCCCGCGCTTCCCTGGCGACGTCTACCCG
AACCTGAAAGCCCTCCTGGGCCTACCAACCGACACCTCGATTGTTCTCGAGTACGCTGCCCGCCACCCCGCACTGCAGCTCGGCTCGCACAAGCTTCGGA
AGACGGCCACTTTCAAGAGTGCGGGTGCTTTCAGCCCCGAAGAGGAGGCTTGGATGGTTGAGGAGCTTCTGGCCATGGAACTCCAGAGTGTACAAAAGAG
CGCAGAGGAGATGGCCGGTTCGACAGTTCGCTCCGCCGTCATTACGGTTCCGCCCTTCTACACCCTCGAGGAGAGGCGCGCCACCGAGACCGCCGCCGAG
CTCGCAGGCCTTCGAGTCCTGTCGCTCATCAGCGACGGTCTTGCCGTTGGGCTTCACTACGCCACTAGCAGAACCTTCCCCAACATCAACCAGGGAGCTA
AGGCGGAGCACCACATGGTTTTCGACATGGGCGCCGGATCCACCACCGCCACGGTCCTCAAGATGCAGAGCCGGCAGGTCAAGGACATTGGCAAGTTCAA
CAAGACGGTCCAGGAAGTTCAGGTCATGGGCAGCGGTTGGGATCGTACCCTGGGTGGTGACGCTTTGAACTACCTGATCGTCGACGACATGATTGCCAAG
TTCGCCGAGTCGCCGGCCGCCAAGAAGGCATCGGTCACAACCCAAGGCGTCAAGGCTCACGGGCGCGCCATTTCGAAGCTCACCAAGGAGGCCGAGCGTA
TAAGACATGTCCTTAGCGCCAACAGTAATACTGGCGCAAGCTTTGAGGGCCTCTATGAAGATGTCGACTTCAAGTACAAGATTGAGCGGGTTGACTTTGA
GAAGATGGCTGAAGATCAGGTTGGCCGCGTCTCTGTCGCCGTGAAGACTGCCCTAGAGACGGCTGGTATTGATATTGCAGACCTCGACTCGGTAATCCTG
GCCGGTGGTGCTACGCGCACCCCGTTCGTCCAGCAGGAGCTGGAGAAGCTTTTTGGCGCCGAGAAGCTTCGCGCCAACGTCAACGCCGATGAAGCCGCCG
TATTTGGTGCTGGCTTCAGGGCGGCTGAGATCAGCCCCAGCTTCCGTGTCAAGGAGATCAGGGTCTCGGACGGTGTCTCGTACGCTTCGGGTATCAAGTA
CAACAACCACAAGGGCAAGCCGACCCAACAGCGTCTCTGGAGCGCTAGGTCGCATCTGGGTGGTCCGGCCAAGGAAATCACACTGCCGAACAAGGAAGAT
TTTGAAATTGAATTCTACCAGCAGGTCCCGCAACTCCCTCCTGCCACCGGCTCGGATATCGAAGCACCCACTGCCAAGCTTACTACCAAAAACCTGACGG
CTTCCGTTGCCGAGTTGAAGGAGAAGTACTCGTGTGAGCCTAGCGACGTCCAGTTCAAGCTCAGCGTCAGATTGAGCGGCGAGAATGGCGAGGTCGATGT
CACCAAGCTCACCGTCCAGTGCGAAACTGAGACTCAAGAGAAGAAGGGAGTTGTCGATGGTGTCAAGAACCTCTTTGGCTTTGGAAAAAAGGAAGACCAG
AAGCCCCTCGGCGGCGAGAGCGCCGATGGATCCTCGTCCAGCTCAGCTTCATCCAAGAGCACCAAGTCCGCCAAGTCTCCGGCATCAACTACGAGTGGAT
CCGCCTCGGCCTCGGGATCCGTGGAGCCTAGCGTTCCCCAGAAGAAGCTCGTTGTGATTCCTGTGCAGTTCGAGCTTGTCAAGGATGGAATCCCTGAGCT
TTCCAAGGCAGAGCTCAAGGCCTCAAAAGACCGTTTAAAGGCTTTCGAGGCCTCTGACAAGGCACGTCGCCAGCGCGAGGAAGCTCTCAACCAGCTCGAG
GGCTTTACGTACAAGGTCAGAGATCTCCTCGAGAACGACGACTTCGTGAAGGCTTCTACGCCCGAGGAGCGGACAAAGCTCGAGAAACTTAGCAGCGCTG
CGAGCGAGTGGATCTACGATGATGGCGCCGATGCCCCCAAGGCCGAGCTCAAGACGAGACTAAAGGAATTGACAGATATCGTTGACCCGATTCAACTGAG
AATCGAGGAAACTAGGAAGCGACCTGAACTTGTCAAGGGACTGCAGGATGCGCTCAAGCAGACAGAGGAATTTGTCGAAAACATCAAGAAGAGTATCGCT
GAGTACGATGCATTCAAGTCGGCCGAGGCTGCTTCATCCTCGTCCACCATTGAGTCGGCGGCGCCTGAGGCAAGTCCTAAGGATGAGTTCGCAGGTCTGG
AAGATAATGAAGCCAAGGCAAGCAAGGACAAGGAGCCTAGCATGGAGGACCTGAACAAGGAGCGTGGTCCAGTCCCGCCGATGTACACACCCGATGATCT
CACTGAGCTCGAGGAACTCAAGGCGAAAATTGTTCCATGGCTCGATGAGAAGCTCAAGGAGCAGTCCAAGCTTGCCGAGACGGCCGACCCAGTCCTTACC
ATCAAGGAACTGACTACGTGGCGTACCAAGCTGGACAAGGCCGGTATGGACTTGACGATGAAGGGCGTCAGGAACTTTGAGAAGAGGAAGAAGGAGGAGG
ACGCCAAGAAAAGGAAGGCGCAGAAGAAGGCGAGCGGTGCGAAGTCGGACAAGCCGGTTAAGATAGAGCTCGGCAAGGACGGCAAGATGCCGACGCAAGA
GGAGCTGGAGGAGCTGCTGAAGCAGTATGCGCCGCCCGAGACAGAAGGTGACGACAAGAAGGCGGAGAAGAAGAGCGATGACACCAAGATCAAGCATGAG
GAGTTATAATTTGCAGGAAAGGGGGCTTTCGTGCGGGGGAAAAAACTGACGATTCACATGCGAGACTTTTAGACGTTATGGATTTCAGTGGCGATATACA
GATTTTAGCATGTAGAACAAGGAAAGATTCAAGGGCGAGCCGTTGTCACCGCCTCTGGTATGTTCTGACAAGCTCTCCCAGTATAATCGTCTATGCAGAT
GGTTTTTTTTTTACTTTTTTTTTTTTTCCAGCTTTGCAACGGTCGAGAAGTAGCAGAAAACCCAAGGGGACCGACCAAGGTAAGTAGAAAAAGCCTCACT
GGTGCCACATTTGCAGGGAAGCCATAAGCCCTGCACCCTTCTACTCGTCACCTCGGCAGATAAGGACTATTGATGTACAAAGCGGAGGGAACATTGTTCC
Copyright 2006 Fungal Plant Pathology Lab. & FBL
E-mail : yonglee@snu.ac.kr
Magnaporthe oryzae ATMT Database