Home   Guide to ATMT Database   Sitemap   Contact  
Sequence ID  5332345
Locus Name  MGG_07146.5
Gene Name  
Protein Name  hypothetical protein
Species Name  Magnaporthe grisea [Magnaporthe oryzae 5 PROTEINS]
Protein Sequence
[892 aa]
+  1
101
201
301
401
501
601
701
801

MALIHIFFLLSSLVSLAQQAELADYVFTNTGSEGGGNTFPGVSEPFGMVKLGPDVFQDRVDSYSGYLPNGKIKAFSMLHLSGTGGAPKYGVVAQMPVVGNIANPLDDYLAARDAPDMTEVGYYKSRLATGITVELAASSRAGMLQYTFPSGPTPRNVIVDVSHVLPSYRGQGLGQRYLGGSISVDRDDSGNVQYKGSGSYDNGWNRAPKWTVYFCGAFNSSATFKTFVGTNATANTLSKFSNDNKVESLSRLGAVFTFDAANVVSRVGVSFISEDQACTNLDQQIPESTSISQLRQKTRDVWNTDVLSRVASNDKNTTKLQHLYTSMYFMHLMPINKTGENPEWKSTEPYYDDIFTLWDLFRCTTALLHVFQPKVYEEFIRSLIDTWRHEGYLPDARSSFFNGATQGGSNADTVLADAYVKGVRGQINWEDGFAAMVKDAEVVPALNDDPRDKTGSTKEGRGALPDWKERGFLSTKFERSVSRAVEYSQNDFGLSQVAKGLGKTAEAEKYMKRSRQWRSHWNKDMKALGFSGFLGPKGEDGQFEEQDPLNCRGCYWGDNYYEALPWEYTFGPHHDISTLIDYSGGPRRFASRLQWTFEPNVRPKGHERFNRMIFDPGNEPSFTTPYLYNFVGRQDMTVNTTRYLGKTYYGVRPNGLPGNSDAGAMESWILWVMLGLYPMTGQTTFLIGSPWLDDITISLGDGKSLQITSTGGSEDSFYVQSLKVNGKNWTKTWVTWDDIFAKGGKLEFTLGPEPSNFGATSPESPPPPSPASEYKSGETYMGNLGGYTSNMNSGGHPSWLIPVAVTVPIVVVAAFAICVTFFFIRRRRAAAAQKALSSGSGTPESGIETLTPTSQPVDTSKTNVQVEIVGAPPLDSTQGANIAQLPPPVANR
IANPLDDYLAARDAPDMTEVGYYKSRLATGITVELAASSRAGMLQYTFPSGPTPRNVIVDVSHVLPSYRGQGLGQRYLGGSISVDRDDSGNVQYKGSGSY
DNGWNRAPKWTVYFCGAFNSSATFKTFVGTNATANTLSKFSNDNKVESLSRLGAVFTFDAANVVSRVGVSFISEDQACTNLDQQIPESTSISQLRQKTRD
VWNTDVLSRVASNDKNTTKLQHLYTSMYFMHLMPINKTGENPEWKSTEPYYDDIFTLWDLFRCTTALLHVFQPKVYEEFIRSLIDTWRHEGYLPDARSSF
FNGATQGGSNADTVLADAYVKGVRGQINWEDGFAAMVKDAEVVPALNDDPRDKTGSTKEGRGALPDWKERGFLSTKFERSVSRAVEYSQNDFGLSQVAKG
LGKTAEAEKYMKRSRQWRSHWNKDMKALGFSGFLGPKGEDGQFEEQDPLNCRGCYWGDNYYEALPWEYTFGPHHDISTLIDYSGGPRRFASRLQWTFEPN
VRPKGHERFNRMIFDPGNEPSFTTPYLYNFVGRQDMTVNTTRYLGKTYYGVRPNGLPGNSDAGAMESWILWVMLGLYPMTGQTTFLIGSPWLDDITISLG
DGKSLQITSTGGSEDSFYVQSLKVNGKNWTKTWVTWDDIFAKGGKLEFTLGPEPSNFGATSPESPPPPSPASEYKSGETYMGNLGGYTSNMNSGGHPSWL

DNA Sequence
[2679 bp]
+   1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
1801
1901
2001
2101
2201
2301
2401
2501
2601
ATGGCTCTCATACATATTTTTTTTCTCTTGTCGAGCCTGGTGAGCTTAGCCCAACAAGCTGAACTCGCCGACTATGTCTTCACAAATACCGGTTCCGAGGGCGGAGGGAACACTTTCCCTGGCGTGTCGGAGCCCTTCGGTATGGTGAAGCTTGGCCCTGATGTCTTCCAAGACAGGGTTGATAGCTACTCGGGCTACTTGCCCAATGGAAAAATAAAGGCATTCAGCATGCTTCACCTCAGCGGCACCGGTGGAGCTCCCAAGTATGGTGTCGTGGCTCAGATGCCAGTGGTAGGGAATATTGCCAACCCACTCGACGACTACCTAGCAGCACGAGATGCGCCCGATATGACCGAGGTTGGCTACTACAAGTCACGCCTAGCGACAGGGATCACGGTAGAACTTGCAGCCTCTTCTAGGGCTGGCATGCTTCAGTACACTTTTCCTTCCGGTCCGACCCCGCGGAATGTTATCGTCGACGTCTCGCACGTTCTTCCCTCATATAGAGGACAGGGACTAGGCCAGAGGTATCTTGGTGGCAGCATCAGCGTGGATAGGGACGACTCAGGAAATGTGCAATATAAAGGATCTGGCTCATACGACAACGGATGGAATCGAGCTCCCAAGTGGACCGTCTATTTTTGCGGCGCCTTCAACTCTTCTGCTACCTTCAAGACGTTTGTAGGCACCAACGCCACCGCCAACACCTTGTCCAAGTTCTCGAATGACAACAAGGTTGAATCGCTAAGCCGCCTGGGAGCTGTCTTCACTTTTGACGCCGCCAACGTGGTCTCGCGCGTTGGTGTTTCGTTCATATCAGAGGATCAGGCATGCACGAACCTGGATCAGCAGATTCCCGAAAGCACGTCGATCTCACAACTGCGACAGAAAACAAGGGATGTCTGGAACACTGATGTCCTCTCTAGAGTGGCTTCCAACGATAAAAACACGACCAAGTTGCAGCATCTGTACACCTCTATGTACTTCATGCATCTGATGCCGATCAACAAAACCGGAGAGAACCCAGAGTGGAAATCGACCGAGCCATACTACGATGATATATTCACCCTTTGGGATCTGTTTCGCTGCACCACCGCTCTTCTCCATGTATTTCAGCCCAAAGTCTACGAGGAGTTCATTCGATCTTTGATTGACACTTGGCGCCACGAGGGTTACTTGCCTGATGCTCGGTCTTCTTTTTTCAATGGTGCGACACAGGGCGGAAGCAACGCGGACACAGTTCTCGCCGACGCTTATGTCAAGGGCGTCCGTGGGCAGATTAACTGGGAAGATGGGTTTGCCGCCATGGTCAAAGACGCCGAGGTTGTCCCGGCTTTGAATGACGACCCTCGCGACAAGACAGGTTCAACGAAGGAAGGAAGAGGAGCGTTGCCCGATTGGAAAGAACGAGGATTTCTCTCTACCAAGTTTGAGAGATCTGTGAGCCGCGCAGTAGAGTATTCCCAAAATGATTTTGGCCTTTCACAGGTCGCCAAGGGCTTGGGAAAGACGGCCGAGGCTGAAAAGTATATGAAGCGATCGCGACAATGGAGGAGCCATTGGAATAAGGACATGAAGGCCCTTGGATTCTCTGGCTTCCTTGGACCAAAGGGCGAAGATGGGCAATTCGAAGAGCAGGACCCCTTGAACTGTCGCGGCTGCTACTGGGGTGACAACTACTACGAAGCACTGCCATGGGAGTACACCTTTGGGCCCCATCACGACATCAGCACCTTGATCGACTACTCGGGAGGTCCTCGGAGATTTGCAAGCCGCCTTCAGTGGACTTTCGAGCCTAATGTCCGCCCCAAGGGCCACGAGAGATTCAACAGGATGATATTTGACCCCGGCAATGAGCCAAGCTTCACAACCCCCTATCTTTACAACTTCGTGGGTCGTCAGGATATGACGGTCAACACCACACGCTACCTCGGAAAGACCTACTATGGTGTTCGTCCGAACGGCTTGCCGGGCAACAGTGATGCCGGCGCCATGGAATCGTGGATTCTTTGGGTAATGCTAGGTCTTTACCCCATGACAGGCCAGACCACCTTCCTCATCGGCTCACCTTGGCTTGACGATATCACAATTTCGTTGGGTGACGGAAAGTCCCTTCAAATCACCTCCACAGGCGGCTCTGAGGACTCGTTCTATGTTCAGAGTCTCAAAGTCAACGGGAAGAACTGGACAAAAACGTGGGTTACCTGGGACGACATATTTGCCAAAGGCGGAAAGCTCGAGTTCACCCTTGGCCCTGAGCCATCCAACTTTGGTGCTACAAGCCCCGAGAGCCCACCACCTCCCAGCCCAGCGAGCGAGTACAAGTCGGGAGAAACGTACATGGGTAACTTAGGTGGCTACACTTCCAACATGAACAGCGGTGGTCATCCGTCGTGGCTTATTCCTGTGGCTGTTACGGTACCGATAGTCGTTGTGGCGGCATTCGCCATCTGTGTCACTTTCTTCTTCATCCGCAGGCGCCGTGCAGCCGCGGCACAGAAAGCATTGTCCTCTGGCTCAGGAACTCCGGAATCCGGAATCGAAACTCTTACACCAACGAGTCAACCAGTCGATACTTCCAAGACAAACGTACAAGTCGAAATTGTGGGCGCACCGCCTCTAGACTCAACCCAAGGCGCCAATATAGCACAGCTACCTCCACCTGTCGCCAACAGGTGA
GCGGAGGGAACACTTTCCCTGGCGTGTCGGAGCCCTTCGGTATGGTGAAGCTTGGCCCTGATGTCTTCCAAGACAGGGTTGATAGCTACTCGGGCTACTT
GCCCAATGGAAAAATAAAGGCATTCAGCATGCTTCACCTCAGCGGCACCGGTGGAGCTCCCAAGTATGGTGTCGTGGCTCAGATGCCAGTGGTAGGGAAT
ATTGCCAACCCACTCGACGACTACCTAGCAGCACGAGATGCGCCCGATATGACCGAGGTTGGCTACTACAAGTCACGCCTAGCGACAGGGATCACGGTAG
AACTTGCAGCCTCTTCTAGGGCTGGCATGCTTCAGTACACTTTTCCTTCCGGTCCGACCCCGCGGAATGTTATCGTCGACGTCTCGCACGTTCTTCCCTC
ATATAGAGGACAGGGACTAGGCCAGAGGTATCTTGGTGGCAGCATCAGCGTGGATAGGGACGACTCAGGAAATGTGCAATATAAAGGATCTGGCTCATAC
GACAACGGATGGAATCGAGCTCCCAAGTGGACCGTCTATTTTTGCGGCGCCTTCAACTCTTCTGCTACCTTCAAGACGTTTGTAGGCACCAACGCCACCG
CCAACACCTTGTCCAAGTTCTCGAATGACAACAAGGTTGAATCGCTAAGCCGCCTGGGAGCTGTCTTCACTTTTGACGCCGCCAACGTGGTCTCGCGCGT
TGGTGTTTCGTTCATATCAGAGGATCAGGCATGCACGAACCTGGATCAGCAGATTCCCGAAAGCACGTCGATCTCACAACTGCGACAGAAAACAAGGGAT
GTCTGGAACACTGATGTCCTCTCTAGAGTGGCTTCCAACGATAAAAACACGACCAAGTTGCAGCATCTGTACACCTCTATGTACTTCATGCATCTGATGC
CGATCAACAAAACCGGAGAGAACCCAGAGTGGAAATCGACCGAGCCATACTACGATGATATATTCACCCTTTGGGATCTGTTTCGCTGCACCACCGCTCT
TCTCCATGTATTTCAGCCCAAAGTCTACGAGGAGTTCATTCGATCTTTGATTGACACTTGGCGCCACGAGGGTTACTTGCCTGATGCTCGGTCTTCTTTT
TTCAATGGTGCGACACAGGGCGGAAGCAACGCGGACACAGTTCTCGCCGACGCTTATGTCAAGGGCGTCCGTGGGCAGATTAACTGGGAAGATGGGTTTG
CCGCCATGGTCAAAGACGCCGAGGTTGTCCCGGCTTTGAATGACGACCCTCGCGACAAGACAGGTTCAACGAAGGAAGGAAGAGGAGCGTTGCCCGATTG
GAAAGAACGAGGATTTCTCTCTACCAAGTTTGAGAGATCTGTGAGCCGCGCAGTAGAGTATTCCCAAAATGATTTTGGCCTTTCACAGGTCGCCAAGGGC
TTGGGAAAGACGGCCGAGGCTGAAAAGTATATGAAGCGATCGCGACAATGGAGGAGCCATTGGAATAAGGACATGAAGGCCCTTGGATTCTCTGGCTTCC
TTGGACCAAAGGGCGAAGATGGGCAATTCGAAGAGCAGGACCCCTTGAACTGTCGCGGCTGCTACTGGGGTGACAACTACTACGAAGCACTGCCATGGGA
GTACACCTTTGGGCCCCATCACGACATCAGCACCTTGATCGACTACTCGGGAGGTCCTCGGAGATTTGCAAGCCGCCTTCAGTGGACTTTCGAGCCTAAT
GTCCGCCCCAAGGGCCACGAGAGATTCAACAGGATGATATTTGACCCCGGCAATGAGCCAAGCTTCACAACCCCCTATCTTTACAACTTCGTGGGTCGTC
AGGATATGACGGTCAACACCACACGCTACCTCGGAAAGACCTACTATGGTGTTCGTCCGAACGGCTTGCCGGGCAACAGTGATGCCGGCGCCATGGAATC
GTGGATTCTTTGGGTAATGCTAGGTCTTTACCCCATGACAGGCCAGACCACCTTCCTCATCGGCTCACCTTGGCTTGACGATATCACAATTTCGTTGGGT
GACGGAAAGTCCCTTCAAATCACCTCCACAGGCGGCTCTGAGGACTCGTTCTATGTTCAGAGTCTCAAAGTCAACGGGAAGAACTGGACAAAAACGTGGG
TTACCTGGGACGACATATTTGCCAAAGGCGGAAAGCTCGAGTTCACCCTTGGCCCTGAGCCATCCAACTTTGGTGCTACAAGCCCCGAGAGCCCACCACC
TCCCAGCCCAGCGAGCGAGTACAAGTCGGGAGAAACGTACATGGGTAACTTAGGTGGCTACACTTCCAACATGAACAGCGGTGGTCATCCGTCGTGGCTT
ATTCCTGTGGCTGTTACGGTACCGATAGTCGTTGTGGCGGCATTCGCCATCTGTGTCACTTTCTTCTTCATCCGCAGGCGCCGTGCAGCCGCGGCACAGA
AAGCATTGTCCTCTGGCTCAGGAACTCCGGAATCCGGAATCGAAACTCTTACACCAACGAGTCAACCAGTCGATACTTCCAAGACAAACGTACAAGTCGA
Position in Contig 1279010 ~ 1281801 (2792 bp, 113 bp) in Magnaporthe grisea 70-15 supercontig 5.195 (Strand +) (Frame : 2)
Chromosome Chromosome : Not defined!
Contig Sequence
(1269001 ~ 1291800)

+1269001
1269101
1269201
1269301
1269401
1269501
1269601
1269701
1269801
1269901
1270001
1270101
1270201
1270301
1270401
1270501
1270601
1270701
1270801
1270901
1271001
1271101
1271201
1271301
1271401
1271501
1271601
1271701
1271801
1271901
1272001
1272101
1272201
1272301
1272401
1272501
1272601
1272701
1272801
1272901
1273001
1273101
1273201
1273301
1273401
1273501
1273601
1273701
1273801
1273901
1274001
1274101
1274201
1274301
1274401
1274501
1274601
1274701
1274801
1274901
1275001
1275101
1275201
1275301
1275401
1275501
1275601
1275701
1275801
1275901
1276001
1276101
1276201
1276301
1276401
1276501
1276601
1276701
1276801
1276901
1277001
1277101
1277201
1277301
1277401
1277501
1277601
1277701
1277801
1277901
1278001
1278101
1278201
1278301
1278401
1278501
1278601
1278701
1278801
1278901
1279001
1279101
1279201
1279301
1279401
1279501
1279601
1279701
1279801
1279901
1280001
1280101
1280201
1280301
1280401
1280501
1280601
1280701
1280801
1280901
1281001
1281101
1281201
1281301
1281401
1281501
1281601
1281701
1281801
1281901
1282001
1282101
1282201
1282301
1282401
1282501
1282601
1282701
1282801
1282901
1283001
1283101
1283201
1283301
1283401
1283501
1283601
1283701
1283801
1283901
1284001
1284101
1284201
1284301
1284401
1284501
1284601
1284701
1284801
1284901
1285001
1285101
1285201
1285301
1285401
1285501
1285601
1285701
1285801
1285901
1286001
1286101
1286201
1286301
1286401
1286501
1286601
1286701
1286801
1286901
1287001
1287101
1287201
1287301
1287401
1287501
1287601
1287701
1287801
1287901
1288001
1288101
1288201
1288301
1288401
1288501
1288601
1288701
1288801
1288901
1289001
1289101
1289201
1289301
1289401
1289501
1289601
1289701
1289801
1289901
1290001
1290101
1290201
1290301
1290401
1290501
1290601
1290701
1290801
1290901
1291001
1291101
1291201
1291301
1291401
1291501
1291601
1291701
CGACCGCGGCGTTCTGGGATGCTTGGTCTAGTTGTGTCTATGTCAGAAGGCGTTCTAGGCTCATGGGCTGCTTCACTTGAAGTATCTCGGCCGCATGCAC
TTACTGTTAGACATGCTGTTGATTGAAGTATTTGATTGGTGGAAGGATAGGGGTTGACCGGTTTAAAGAACAGAGATGGATCTGGTTGGGTATTTGGATG
TATTGCTTGGTATGGATGTTTAAATGCTGATGCTTCGATGTCTCCTGAAATATGAGATCAAATCACATCCCGAGAGGGCTGTCCAGTTCTTATAAGTTCTTGCCAACTTTTCCTCCATACATCCCCCGATACAAAATCTAGTTAAACGCATTTCCATCATTGCTGACGAGGGTGGACACGCATCGTAGACATTGATTCGGAAGCTCATCAGTATGAGTTTGGCATGTACTCTCAAAGAGCATCGACGCCGACAAGGATAAGAATGATTTGAGCTTAGCGTCAAGCACTGCATTGCAACATCCCCCGACTGCTGAGCCACACCCACTCATCAAAAATATGTTAGGTTTGTAAGCTTTCAAGGCTTTGTCCCACAAGATGAGGTGCAACCGACGAACCGACTTCGTTTCGCCAAGCCCCAAGGGCAGCAAAATATGAGTCACATTCAAAAAGCCTGTCATCATTTGGGAGTACTACCTAAAATGGACCAGGTGGTTACTGTGAGATTCAAGCTTATTTGGACTTATCAGTGGATCGCATCTGTCGCCGAGTGACGAGGCAATCTTAAAAAAACCACATGGTCGACGCGGTCAGTGCAGTCATTATTAGACCAGAAACAAAAACCCCACAACTCTGGTGTAATCCAGCACGCGATGGTCGCATGTTGCTCGCAAGGGGATTTTTTTTCTTCTTCTTGATGACGCGGATCAGACAGACATTATCGCGCTGCAGACTCAATCGGGTAGGTGACGCGCCTTTTTCTCGTGCCAAGCCTGTGTAGGTAGGGCTAGATAGGTGACTGAGATCATGGGCAGCCGGGCCCGCGTCGTCAGTCTTTCCCCGCATCCAATCGGCGCAAAACAACGTTATTCAGCGGAGTGGAAGGAGGTGCGTGGTGAGCCAAGGGAGCCCAAGCACTACAAGCATACGCTTTCCCCCCTTATATCTGTGTTTTATTGCTGGATCCTAATGCCAACTGGACTTTGACCATCTGGTTTAACTATCTGCGTAGGACGTTTCCTACACGTGAAGCAATCACCAGTTTAATTGGAGTTTCCATTATTCGGCTTTTTTTTTGTACATAAAAACTGTATGCGTTCGACAGGTCGACGACGCACATCTACCAGTAACATTTGCCACATCCCTCCGTAAGATTTCGCATCAATACATTTCGACAATATGAGAATCTCCGCTGCAGTCCTTGTCACATTCATGGCTGCTGTCACCACAGCCTCGCCCGTGTCGCAATACGATGTCAGCGGCTGCAAACCCGATACGGGACCCAAATATGACCATCACTCACAATAAATTTACCTCGTTTCTAGAATGAGCAGGCACTTGCAGCGGCATCAACACCTGCACCATAGTGAAGGATGGAGCTGTGACCAAGGTTGGTCGATCTTTTGACTGTATCTTGCCAATGTTCACTTGGATGGGATAACGATGGGACAAATATGGGACAAAGATGGGAAGACGGGCATTGGAGATGCAAAAGGTTGAGATTAGAGCAAGTGAGCATGAATACTACAACCATTACGTTTACTTGGACAGAAATATGACTTGAACCGAGCGACGGATTTGGGGCACCTGTACCCCCACAGAATATAACTTGTGTATAGCCACAGGATGGTTTATCGAGATCTCGAATACAATCCTCACAAAGTAGAAGTTTCATGGGCTAATTTGTCTCCACTACGTACGTACTCACTTACGGATTTCTCTGCTCGAATATTCCTACCAAAAACACCAGTTAGGAACATTTGTTGGCGGTTAGCGGTAGGTGGAGGTAGAAAATCGGGGTACTGTCATGGGATTTATGGAAACGAAGATTTCAGAAAGACCATATTTCGCTTTCGGCATAGGGTAGATTAGACCCTATGGCACCCACCTGTAAAGTGGTCCTGCTGCTCTCATCAATCATGGCCATTTGATGCCTCAAGGAGAATGGTGTCCTGAACAAAAGATAACGGCCAAAGAATTCCCCCAGCATAGGCGGGCAATGTGAAGTAAATTTGGAGAAAAGGCAAGTAAGTGGTCACAATATACTACATAGCGCTGTGTACACCGCACATAATTTACTGTGTAAGTGCTTCTCCGTGGAAGGACAAGTGCTACTTGGTCAGCTTCTCTTTCATCAAATGGATGGTAAAAGTTTAATCCGAAACGTATGTCATTGAATAGCAACAATGACCGCAACTTGTAGCTCAAAGAAGAAAATACATGCAAGGCGGGATGAAGATCATTGGAATTGCGTCCAAGACGGTGTGCTGGACTGACTTGGCTAATTCCTTAACCCCAGGCGGGAGTTCCTTAAGTGGCTGACGGTGGAGATTGCGTGTAGGTATGCATAGATCGCGATTTTCCGCCTGATGTCCTCAAAGCCTTCCCGCGCCCGAAAGAAATGTTTTGGGATCGTCACTTATACAGGGATATGGAGGATGGAGGTAATGTAATGACTTTTTGCTCTGGTGCTTTGGAAGAAGAGTCTGAATGTGAAACCGGGCTCATGAAATGGCCAGTGTTGCTCAAAGGTGTACTTTAGGGTAGCAGTGACGACAACAATCACGGTGCGGAGGAGAACTTGACGCTGTCAATGTGATCAGACAGAAAGTCCAGTGAGTGTTAAGCCTCTGCCAGTCGAGAACTGAAGAGTTGCCTCTGGCCAGTAAACATATACCGTAGTCAAGGTAAACGACATGCACGTTACCTACGCTACAATAGCTATTTGGAGGATCCTACTGACGCAAGGTAAATTAATAAATGAATGAATGAATGGCTTAGTTAATTGAGCCGCAAAGCCCGATTCATCAAAGATGAGTTCCACCTCAAGGTGGGGCATTAGCAAGCATGCGTTCCCTTTTCTCATTGGCTGCAAGCACAGACCATGACTTCTTGGCCTTCGCGGCGCGGCTGACCAGCAAGACCAGGTCTGGTGGCCGCTGCCTTGCCTGCCTGATGGAACCGACAACGCACTTCGATTTGTCTTTAACCCAAGATACAGACTTAACCTGTTCATTTTCAACCCAGCCAACTCATCTGGAGCCTAGTCGCCCATCCCGAATATCTTGGGAAACGCATGTGACTCTGTCGCTGCCATAGTCCGGCCGATTAAAATCGATCGCCGTCCTCGACGACAAACAGCCACCTCTACGGTCCATCTCGAAGCTCCCCACCTTACCTAGGTACACACGTTACGAACTCCGCTGCATCTCGAGCAGCCGTAGCAGGCTACCCTGCTTTCGCAAACCCCACAGTAGTACATCCATTCTAGCACCTTTGAAACACCCGCATCTCGTTGTCACTGGCGACTCGGCCTTTCGCGTTTTCTCGAATCGGCAAACAACTTGCCCCCGCGCTCGGGTTCGGACACCGCGTGCATTCGACCATCAGATTACCGAATACCGGAGAACAAGAACAACAGATCCCATGATGGCGCCAGCCTCACGGGCACCGCTGGGCGTCGGGTCCGGTCGGGATGATATCGAAGTCACGTACGTACGAACCTCCGCGTCGCTCGCGCATGCGTGCCCCGCCTCCGGACCGGCAATGCTCCCAGAAATGAGACCTCCTCCTAACTGGTTCTCACAATAGGTGGAACTATCTACAGAATGGAATCACCAGGATCATGAACAACTTACAAGATGGCATGACTATGGAGACGGTAAGCCCGACACCTCGAGAATCTCAATTATGACGGACCTCGCTAACCGACGTCATCGCTTTAGTACATGGGTATCTATACGTGAGTTTCAAGAGACCCGTTCGACTTAAACAACATAACATACTAATGGTAACCCGCAGCTCCGTACACAATTTCTGCACCTCACAGAAAGCTCTTGGCTTTTCAAATTCGCCCGGCCCTCCAGCAGCTGCGCACAGAGGAGGTAAGCTAGCCAGAAGCATCCGTACGGCGGTGGACAAAATTGGGCTAATGATCTTCAGCGCATCTTCTTGGTGAGGATCTCTACAAGAAGCTTATGAAATACCTGAGCGATCATCTCGAGGACCTGCTCGTCCAGTCTAAAGCCCATACCGGCGAGGCTTTGCTTAGCTTCTACATAAGAGAGTGGGATAGATACACGACCGCAGCCAAGTACATCCACCACCTCTTCCGATACCTCAACCGCCACTGGGTCAAGCGCGAGATTGACGAGGGAAAGAAGCACATTTTTGATGTTTACACACTGCACCTGGTCCAGTGGAAGAATGTCTTGTTCGACAAGGTTCACGAGAAGGTGATGGATGCCGTCCTTGCTTTGGTCGAGAGGCAACGAAACGGAGAGACCATAGAGTATGGTCAGATCAAGCAAATTTTAGACTCCATGGTCTCGTTGGGCCTGGATGAGAACGACGCGTCCAAAACCACGCTGGACTGCTACCGTTTCCACTTCGAGAAGCCTTTTATCGCCGCTACGGAAGCATACTACCAAAAGGAGAGCCGCGCGTTCGTCGCGGAGAACACTGTGGTTGAGTACATGAAGAAGGCGGAGGCGCGTTTAGAAGAGGAGGAGGAGCGAGTCCGAATGTACTTGCATCCCGACATTGCCGTGGCACTCAAGCGCTGCTGCAACACCGCTTTGATCGCAGACCACTCGGCGATTCTCAGGGACGAATTTCAAGTACTGCTGGATAATGACCGCGAGGATGATATGGCGAGGATGTACAACCTTTTAGCTCGAATCAGTGACGGCCTCGACCCACTGCGTCAGAAGTTCGAAGCCCACGTGCGACAAGCTGGCCTGACGGCCGTGGCCAAGGTCGCATCTGGCCAGGGCGAGAAGCTGGAGCCCAAAGTGTATGTGGATGCGCTGCTCGAAGTCCACACGCAATACCAGGGATTGGTCAAGCGGGCATTCAACGACGAGCCAGAGTTTACACGATCTCTTGACAACGCCTGCCGAGAATTTGTCAACCGGAACGACGTTTGCAAGTCCGGATCCAACAAATCCCCTGAGCTGCTTGCCAAATACACGGATGTTCTCCTTCGCAAGAGCGGCAGTGCCGTCGAGGAGGAGGAGCTGGAGAACACTTTGAGCCAGATAATGACTGTCTTCAAGTACATCGAAGACAAGGATGTCTTCCAAAAGTTCTACTCCCGGATGCTGGCCCGGCGTCTCGTGCATACCAACTCATCCTCGGATGACGCAGAAACTAGCATGATCAGCAAACTGAAGGAGGCATGTGGCTTCGAGTACACCAACAAACTGCAACGCATGTTCCAGGACATGCAGATTTCGAAAGACCTCAACACGGGTTTCCGTGAGCATGCTGAAAAGTCCGAGATGAAGGTTTTGGACTCGCAATACGCGATCCTCGGAACTGGCTTTTGGCCACTACAAGTCCCCAATACTGCCTTCAACCCCCCGGCGGTCATATCCGAGGATTGCGAACGGTTCACGCGCTTCTACAAGAACAAGCACGATGGCAGAAAGCTCACTTGGCTTTGGCAGCTGTGCAAAGGTGAGGTTCGAGCGACCTACTGCAAGCAGAGCAAAGTGCCATACACCTTCCAGGTGTCCATGTACCAGATGGCGATTCTTTTGATGTTCAACGACGGCGATCGTCACACGCATGAGGAGATAGCATCTACTACCTCTATGAACAGCGAGACCATGGACCCCGTACTAGGCCTCTTGCTGAAAGCCAAGGTCCTTCTGGCAGACAGTGACAAGCCAGGCCCAGGGACCACATACAGCCTGAATTACGACTTCAAGAACAAGAAAGTTCGTGTCAACCTGAACATTGGTTTGAAGACAGAGCAGAAGCAGGAAGAGGTGGAGACAAACAAGACAATTGAGGAAGACCGAAAGCTTCTTCTCCAGGTGAGTACATATTCACGAGTTTCTCTGGTTGCGTGCGAATATCTGTTTATGATGCTGACATTAAGCTATTTCGTGACAGTCGGCCATTGTGCGTATTATGAAGGCTCGTAAGCGTATGAAGCACAACCAGCTGGTTAGCGAGACCATCGGTCAGATCAAGGGACGGTTTGTGCCCAAGATTCCGGACATCAAGAAGTGCATTGAGATTCTTTTGGACAAAGAATACCTAGAGCGTCTGGAGGATGATGATCTCGGCTACCTGGCCTGATCGAAGCGAGGGACCATGGAAGCTTTGCGGGCAGCACTAGTAACTGATGCTATCACAAGGATTCGACAAGAATCCAGTTTTTAGTGGATGCTCGCTCGCTTGGGATCTTGTTACGATTGAAGGTTCTGTGATACAAGCAATGCATGGGTATGAAATCGATGAGGATATGGGATCATGGCAAGGAAGCCAGGACGTTACGGAGGCCAGGAACATCTTTCTGGGCGGAACATACACTCGCAATCAGCATTGCAAATTTGTACTTGAATACCCAAAATTGCTACACTTGTGGCTGTTACTTTGAGGTGGCTGTTACTCGTACCGAGTATCAATATTTGTCTTCCCCTGAGTCTTTTCGTCGTGACTCCACTAACGTTGGAGGGATGAGGCTTCATGGTGGAGGAGGAGTAGGATTGGAGGCAGGGCGACTGTAATTGCATTGTCTTCATGCGAATTGCTTGACTTACATTCGACAGTGTGATTCGGGACCATTTTCATGCAGTGAAGTGTCCCAGTTAGCGGTTATATATGCTCCACGCAGTTCGCGTCCGCACCGGCTATCTTTTAGCGGTGAAACTCAAATTATAAGGACATGTGATATACCGATATTTGGAGATCTTCAAACAGGTGGATTAGTAGGTAGGTTTGAGCGTTTCTGTGGCTATATTGGGTGGCCCCAGAGTGACTGCTACGTGGTAATTATTGGAATTGACTGTTTGACAAGTGCTCCCCCCCCCCCCCCCTTTTTTTTCCCTTCTTCTTTTTTTTGTCTTCTCTTCCTCACCCTTGAATAGAAGAGTTAGTCAGTCGTGCATGGATGATCCAGGTTGATTAGCTACCGTAGAAGCTGAAGAACGTGAAGGCGAAATTGAGAAGAAATCAAATAAAGCCTCGTATACGGATGATACCTACCTACTCAAGTACCGGGCAGCTACTTCGTACTTTTTGCGTAGCCATTGGTGTTCTATCTCGCTTGAGCTTCGTATCTACAGTGTTGCTCTGAGTCTACTACAGGTCTAGACCAAACACCCACAGATGCCAAGGGCTTTTTTGTCAAGGACATACATGGTACTGCACAGGTGCACAACTGAACATACCCCATTAAACGCTTAGCATCCCCAAGTTCATGGTTTTTCTACCGACAAAAGGCCAAGAACTCTTTGCCTTGGCTTTTCCCTAAAGCTTGGCGTTTGATCAGACCCTGCGAGGTCTCATAATGAGTTATTTACCGAAACATGTTCGTGCGGACTTGCCTTTCAAGTGAAAAATGCTACGTTATTTCGCTTCGCTTCTTGCCAGAAATGCCAGGGGATTCTCCGCAATCGTCGTCTATGGAGGAGGGGGGGGCGCCTCTTTTTTTTGGCACATAGGTGGGGCGGCGCGACTCCGTAGTCTCCGTCTGCTTGTAAGGAAAAAAAAGATAAACATAAAAATAAAAATAAAATAGAGAACGGGGCAATTAATGCCGTGGGCTTATGGGGACAGAGGACATCCGGAAGTTCGAGTCTGAACCCAGGGAAGAATGGGCCTGAGACGAACAATGACCTTTCTTCTCGTTAGCACATCTGTCATGTCGTTTTTGGGGGGAGGACGGTCCCCTCCCGACTCTGAATCCGACTGCCCGTGTGCCAACGATTGATGGATGAGCAACGACGGGATGGGCATGCCATGTCAGCTATGAAAGAAAAAAAAAGACTTTCATGCACCACCAACCCCCAAATGCACCCACTTTGTCATTACATGTTGTACATTATGGTGGGGAGGGGAGCTGGTAAGCAAACATGCGCGTGGCATCAATGGCACATCGCATAGAAAAAAAAAAACATACAAAAGTTCGCAATCATCTATCCACACAAAGCGCGTCGTGGGGGCTTGGAGCCAGACGAGAGGTCAGCATCGCCAGCTGCAGGGACTTTTTGCGGTGTGTGTGTGTGTGTGCGCCACGCGACGCAGCTTGTGCCTGTGTTCAAATTCGTGCCTGGTGTTGTTAGCAAAATGGCCTGGTCCAGGCCCTTTGGATTGTCAAAAGCTTGACCTTTCCTGATTTGGAAATTACAGCACAAAGGGAACAAAAGATTCGCCCAAGCCCCCTCCCCCCTGCGCCTAGGGGACCACACTTGCACACATCACACCCACCAACGGGAGGCTTGTCAATCGGACTCGGCGGGTTGTCCCAGAGCTTGGCGATGGGTGCTGATCTAAAAAAAAATCTCGGCGCAGTCAGATTCCGATAATCCTGTGCCATTCTCAGGGCTGTCGGTATGTCATCTGGCTGGCTAGTGCAGCTGGCGATTTGAAGGAATGGCAATCGACGCTTTAGACATCATCATTCTTTGATGTAGAATTTTTTATACTTGTGGTTTTCTTCTTGTCCACTCGGGAATTTTAATCGCTCTCATTTCCTGCTCAAGGTACAGTGGGCTTGCATTTGTGCGTTATGTTCTGCATACCCGAAAGTAGTTCCGAGGTACCTAATTTTCTTATGTGTCTACGGAGTAATCTTCATCATCTAATTTCCAGGGTACCTTAGAAGCTTCCTATATTGCTTCTGTTGTCTTTTTCTCAATGCGCTGCTGAAATGTCTCGGTGCCAGCCAGCCTGCCTACGCCTCAGCAATGCCAGAATTCTGGACCTTTGTGTTCTGCGCACTCGCCTCGAATCCAAATTTGGCGCTGCCCAAAAAGCTTAGCTTCAAGGCTACCGAGTTATGGCCAAGGATCAAGGCCTGTGGACCCACAACATTGAGTTCCTTGCTGTGGTCCACCGAGCGAACCCATGTTTCTGGGGGTTCAGTCGGGGGGGCCGGCATGTTTTCCCCTTTGTTTGTCTTACCCCCCCAACCATTTCCCTATCCGACGAAACCAGTTTTTTCTCTCTCTTGCACCGGCTCGTTTTCTTCGCGCTGGTCGAAACGGTCGCCATGACTATTGATTTCCAACCGTCAATCTGCGGCTTGTTCCCTAAACTTGACGATTCCGATAGTTGCAGTTCGTCAAATCTCCTCGGGGCTCCCTTTATCAAAATCAGGAAATGCGGCAAAGCGGCATCATGGCAGCAAGTGCCGCCAACAACTGTCACCGTGCCTGCCCTATCGGGTCGAAGAGTATGGCCGTCCGCAAGCCCACGAGAATGGGCTAGGCGTCTTAGGTTTTCTTCTTCTTCTTATTTCTTAGTTTGCATGTTTGTGGAAGTTCCACAGATCTCGGGCGGCTCGTTGGATGCTCAATACCCAGGCAGTCACATTAGTTTCCGAACCACCATACCATACATCCATTACATACACATGTAATACTCACTCTTGATTTTATGCTTCTACCCACGAGGACACAAACGCGCGAGCGAACCAATTCGGTTCACTCGGGCATCATAACCCACACACTCCACATCACTAGACCTGCCAGTGTCACATCTTTGGTGAATAAACGCTGAAGTTGCTCGGGCCCGTCAAAGCTGAAGCGGGTTCGAAAGCTATCTGCAGCGGCTGCGCCCACTGGCCCTGCTAACTTGGGTCAGCACTACGGATCCACAACCGTCGAACCCTGTGGCCTGCCAGACACGCACACCCACCTCCCGTCTCGACCACCCCAGGGGGGTGCACCCCTGCTTGCGCCACTGTTCTAGATTTCTGTTCCTGGATTCATATACCCCGTCCGCCCCAGATGAGAGGGCTACCGTTACAATGGCCTTGCCTCAGTTCTACGCACATTGTCTTCTTGGGCTTCTCCATGGCTCTCATACATATTTTTTTTCTCTTGTCGAGCCTGGTGAGCTTAGCCCAACAAGCTGAACTCGCCGACTATGTCTTCACAAATACCGGTTCCGAGGGCGGAGGGAACACTTTCCCTGGCGTGTCGGAGCCCTTCGGTATGGTGAAGCTTGGCCCTGATGTCTTCCAAGACAGGGTTGATAGCTACTCGGGCTACTTGCCCAATGGAAAAATAAAGGCATTCAGCATGCTTCACCTCAGCGGCACCGGTGGAGCTCCCAAGTATGGTGTCGTGGCTCAGATGCCAGTGGTAGGGAATATTGCCAACCCACTCGACGACTACCTAGCAGCACGAGATGCGCCCGATATGACCGAGGTTGGCTACTACAAGTCACGCCTAGCGACAGGGATCACGGTAGAACTTGCAGCCTCTTCTAGGGCTGGCATGCTTCAGTACACTTTTCCTTCCGGTCCGACCCCGCGGAATGTTATCGTCGACGTCTCGCACGTTCTTCCCTCATATAGAGGACAGGGACTAGGCCAGAGGTATCTTGGTGGCAGCATCAGCGTGGATAGGGACGACTCAGGAAATGTGCAATATAAAGGATCTGGCTCATACGACAACGGATGGAATCGAGCTCCCAAGTGGACCGTCTATTTTTGCGGCGCCTTCAACTCTTCTGCTACCTTCAAGACGTTTGTAGGCACCAACGCCACCGCCAACACCTTGTCCAAGTTCTCGAATGACAACAAGGTTGAATCGCTAAGCCGCCTGGGAGCTGTCTTCACTTTTGACGCCGCCAACGTGGTCTCGCGCGTTGGTGTTTCGTTCATATCAGAGGATCAGGCATGCACGAACCTGGATCAGCAGATTCCCGAAAGCACGTCGATCTCACAACTGCGACAGAAAACAAGGGATGTCTGGAACACTGATGTCCTCTCTAGAGTGGCTTCCAACGATAAAAACACGACCAAGTTGCAGCATCTGTACACCTCTATGTACTTCATGCATCTGATGCCGATCAACAAAACCGGAGAGAACCCAGAGTGGAAATCGACCGAGCCATACTACGATGATATATTCACCCTTTGGGATCTGGTAAGTCCAGCCGGACCTGGGCGAAACAAAGCACGTTTACTGACAACTCCTGTAGTTTCGCTGCACCACCGCTCTTCTCCATGTATTTCAGCCCAAAGTCTACGAGGAGTTCATTCGATCTTTGATTGACACTTGGCGCCACGAGGGTTACTTGCCTGATGCTCGGTCTTCTTTTTTCAATGGTGCGACACAGGGCGGAAGCAACGCGGACACAGTTCTCGCCGACGCTTATGTCAAGGGCGTCCGTGGGCAGATTAACTGGGAAGATGGGTTTGCCGCCATGGTCAAAGACGCCGAGGTTGTCCCGGCTTTGAATGACGACCCTCGCGACAAGACAGGTTCAACGAAGGAAGGAAGAGGAGCGTTGCCCGATTGGAAAGAACGAGGATTTCTCTCTACCAAGTTTGAGAGATCTGTGAGCCGCGCAGTAGAGTATTCCCAAAATGATTTTGGCCTTTCACAGGTCGCCAAGGGCTTGGGAAAGACGGCCGAGGCTGAAAAGTATATGAAGCGATCGCGACAATGGAGGAGCCATTGGAATAAGGACATGAAGGCCCTTGGATTCTCTGGCTTCCTTGGACCAAAGGGCGAAGATGGGCAATTCGAAGAGCAGGACCCCTTGAACTGTCGCGGCTGCTACTGGGGTGACAACTGTAAGCCATGAATATTCCTAAACACTTGCAAGTGTGACTGGTCGCTAACATCAAACAGACTACGAAGCACTGCCATGGGAGTACACCTTTGGGCCCCATCACGACATCAGCACCTTGATCGACTACTCGGGAGGTCCTCGGAGATTTGCAAGCCGCCTTCAGTGGACTTTCGAGCCTAATGTCCGCCCCAAGGGCCACGAGAGATTCAACAGGATGATATTTGACCCCGGCAATGAGCCAAGCTTCACAACCCCCTATCTTTACAACTTCGTGGGTCGTCAGGATATGACGGTCAACACCACACGCTACCTCGGAAAGACCTACTATGGTGTTCGTCCGAACGGCTTGCCGGGCAACAGTGATGCCGGCGCCATGGAATCGTGGATTCTTTGGGTAATGCTAGGTCTTTACCCCATGACAGGCCAGACCACCTTCCTCATCGGCTCACCTTGGCTTGACGATATCACAATTTCGTTGGGTGACGGAAAGTCCCTTCAAATCACCTCCACAGGCGGCTCTGAGGACTCGTTCTATGTTCAGAGTCTCAAAGTCAACGGGAAGAACTGGACAAAAACGTGGGTTACCTGGGACGACATATTTGCCAAAGGCGGAAAGCTCGAGTTCACCCTTGGCCCTGAGCCATCCAACTTTGGTGCTACAAGCCCCGAGAGCCCACCACCTCCCAGCCCAGCGAGCGAGTACAAGTCGGGAGAAACGTACATGGGTAACTTAGGTGGCTACACTTCCAACATGAACAGCGGTGGTCATCCGTCGTGGCTTATTCCTGTGGCTGTTACGGTACCGATAGTCGTTGTGGCGGCATTCGCCATCTGTGTCACTTTCTTCTTCATCCGCAGGCGCCGTGCAGCCGCGGCACAGAAAGCATTGTCCTCTGGCTCAGGAACTCCGGAATCCGGAATCGAAACTCTTACACCAACGAGTCAACCAGTCGATACTTCCAAGACAAACGTACAAGTCGAAATTGTGGGCGCACCGCCTCTAGACTCAACCCAAGGCGCCAATATAGCACAGCTACCTCCACCTGTCGCCAACAGGTGAACACACAGCTGTTTTTTTCTGATTTCATCCGCACATATCCAAAAGTTCCGTCTCTGAACATATCCTCCTATTGGGACACGCATTAATTCTCTGTTGCTATTTTTTCTTACATTTTGTTGGCAGCGTTAATATCTGGAGATACCCCGAGCAAACTTGGCTCATCTGACACAAGAATATTTGTTTTTTACGACTGCATAGCTTGGCGCAAGGAGGGATTTTAAAAGAAATCAGAGCATGAGCATTATAGGAATTGCATCAGCGATATACATTATTATTTAGTAAAATATGAAGCGCTCGATCCACAAGGATCCTTACCTCGCCCGCTTTGATCCCTTTCTTTCCGATGAATACATGATAATAAGCCCTCTAAAACTTGGGCGTGAGATGCTCTGATGACACCGAAACACTACAACCGACGGGTGCGTTTATGACTCAGTTTCTTAAATGTTCTACGTTTAAGAGTGACGGGGCAGCAGTTACACGCTGTTCTTCTCGTCCGAATGCCCAACCTCAAAACCTCTAGCCAAACGTGCCAATATTCCAGAGGCCTTGGGCAATGCAATGTGGCGAATTAGGCGACATCCCAGTTACCCATGTCGTCGGCCGCTTCATAGTCCATGTTCTCATCATCATCCCCATCGCTGTCTCGCGGAGAGCCGTGATCCCGGGCGCCGTCATTCATGGCATCGTCGTTACCGTCTGCCGAATCTCTGGCCTCGGCACCCTGCTGTCCAGGGCTCGGTTTCGAGCTGTTGGCTGCCGTCTCGGCGGCCGAGTTGGGAACCCAGGCCAGCTCGATCGGCGCCTCTATGCCGGGTATGCCTTTGCCGCTGCTCAGTCCGTAGTAGAAGGTCTCTGCCGTTCTCCGGTCGCTGAAGGAAACATGCGCCGTGCCACCGTCCTGCACCTGGATCTCCTTGAACTCACCAACGCCCTACAAAGTAACGAGTATTCCAGTCAGTAAACCGAAGCTAATAAAGAAGACACCAGCAACAGGAAGAAGATTTTGCGAAGACACGGATGCCAAGCCAAGAACTTACAAGAAGGTACTGCCGGAGGGCCTCGTCCTTGTCCGCCGTCGAGAAATCAACGCCAGACACGGCAACCCGCTTGGGTCGATGATCCAACGAGTACATCGCGTATGCAGCGTGGTGGTTACCCCTGCCCCGACCTCGGTATCCTCCCCGAAACCCAGCCCTCGGCGGATATGAGCTGTAGTGGGGCGCGAAAGGATACCCTCCACGGCCGCGGCCCCTGTACCCACCGCGACCGCGATATGCAGGAGGCCAGGACGACGTTTCTGTCGATTCCTCTGGGTTGAGACCCATAGACCTTGCCTCTTCCTCTAGGGCTGCCAGAGTTGCACGCAGGGCCCTCGTCTCTTCGCTCTCGGGCTTGGAAGACGAGCCACCATCCGTAGAGAAAGTGACCTCTGGGGACAAGTCACGATTATGTGACTCGCCAGCGCCCCGAGCGGCAAGCTTGGCCCTGAGCTTCTTACGCTCCTCGTGAAGCTCCTTTTGCCGCTGCTCCAAATCCTGGCGCTGGCGATCTAATTCCTCCCTCTTCCGTTTCTTTTCTTCAAATATCTTTTGCGCCTCCTCCTGCCTGCGTGCAAACTCCTCCGCGTCAACCTCAGGCTCTGCAGCAGAATGTTCTTCGCCTGTATCGGGATTACCGCCGTTTGTTGCATGCGGAAGTTCAGTGTTGCCTCCACCGGAGGTACCGTTGGTGCCCGCTGGTTTCCCCAGCTGTTCATCGTCGTCCTCCTTGCGCCAAAATACCCTGACAAAGCGATTGTCAAAGATCACCTTTGGTGACCTATATGCCGCGTTTGCCGATGCCCAGGTATCGTATTCAACCACTGCCAACCTTTTGTAAGGTTGCATGGACACTGAAACGATGGTTCCGAACTGGGAAAAGAAACCCCTGACTTCCTCCTCAGTGAAGTTCTCCTCGGGAATGTTCTCAACCACTATGGTAGATCGGCTCTTATCATGGACAGGGCCCTCAGCTGAGAGCTGTGAGCGTCTTCCACCTTTGCCCTTGGGCCCTTTTGCCTGGCGATTGTCCATAGGAAACTTGGGCTGACTGCCATTGAAGGGGAACCCTGGTAGCGGGGGAAGGTTCATTGGCATCATTTTCTGACCATGACCTTGAGGGAGCAACAATGCCGCATTTGCGGGATCATACCCTGCAAGTAGAGGTCAGCTAACGTTCAAAAACCATCCGACCCTCAAATGATTTCCAACAAAAAAAAAAAAGATTCTGAGGCGCATACCTTCGAATTGGCCCGCTGGCGGTGGCACCATATCAAAGCCTGTCGGAGGACCATGTTCGAACTTGCACGTGTTACCTCTTGTACAGTAGCCCTGCGCATCGTAGTCCCTGCATCGTCCTCGTCTGGATCCTTGACCCCTTCCTGATCTCTGAAATCGCGGCGCCATCACGCCGGCGGCTAGCGCTTGCTGCTGTTGTGCCATGAAGGCTTGCATCGAGTCGAGCATGGCTATCGCGTCGTACTCAAAAGCACCCCCATGCGCTCCGGGAGCCGGCAGGTCAGAGTTTGCCCTCGGGTAGCCATTCTGGCGTCGCGCTTGCTTGCCCCTCCCTCCACCGTACATGCGATCGCCATTCTCCTGCGATTTTGGATCATCGAAATCACGATATTGTCGTTTGCGCGACGAGTTGCCGCTAGGGACGGCGAAGGCTGCTGTGGCCGGAGGTGGTGGAGCGGCCGCATAGTATGCCGAGGCTGGGATCTGAGGTGGTGGCGGCGGTTTTGCCTGAGCCGGTGGTAGCTTGGGGGCCGGGGAAGCACCTGGCAGGAAGGACTTGTATGCGATGGCTGCGAATACGTCGTCGAGGAACACGGTTGATTCTGAGAGCAAAAAGGACCAGTGTTAGTAATGTCACAAATGGCGGGCGGAACCGACAAGGCACGCATATGGATTGGAGTTCCAGGGCGACAGACCCTCTTTGAGGAAGTCAGGAATCTCCTCTTCACAAAGCTTTCGAACCTCGTCAGGGCTACCGTCATGACGCAATAGCGCAAGCACATAGTCTGCTAGAACATCGGGGTCGGCATCGGATCTGAAGCGCGTAAGCGAGGTGGAAGTTATCAGCATTAAGCCATGCGTAATAAGTCAAAGTAATGAATGGAAGGGCTTGCGACGAACGTGTTCTCGAGGCGCTTTACGATCCATGCCTTGAGAAGGGCAGCTTCCTCATCCGAAAAGTGCATGGTGAGCGGGATATGATGGGAGAAAAAAGGGCAGCAGCAGCCCACGATTACGGCTCGTAAGTCATTAATTGATTAATCGTCTGTTTCCCTGGTATCAATTACAAATATCTCGCTATTAAAGGACGAGATTGAAAAGATGTATCGTGGTTGTGGTGTGTTTCTGACAAGCAGTCGGGACTTTGATTTTCAAAATATTTGCCCTGGCGCGGCCCGCGCCAGGATGAAGTCTTAAGGCTTTCACTGGCCCCACTGAGGTGCAGATGAAGCGCAGTCAGTACCTTGCCTTAGCTCTCTTAGGTACCCACTTATATTATAAGGTAGTACTTCGGATTAGTGCAACACGGAACCTTCCACAGAGGAAGGCAGAGACCGGCACTTATCAAGCAGCCAATTCTGTTAGTTAGGTAGGTAGGTAGTAGGTATCTTTAGTAGTCAAAGTGGCCCCATATATTCTGCGCTCGCACCTGGTATATGTAGGTGACTACCTAGGTACCTACCTTAGGTTGGTAAGTACCAAGCAAGTTAAACGTCTGTCTCGTGTTCATATGCATGGGTCCCAAAGGTGGCTGGCAACTACTACAGTCAACTGCTTGTTCAGTGGTCCCTTGAACATTAAGCAAACTAAGCCCGGCTTTTTAAGATTGGGAACGTGCGTCATGAAAGAAACGTATGCAAGGTATCCTGTGATCCAACTGTTTATTCCGAATCCATCCTCGGCCGGCTGTAAGCACTATATGCTACGCCGAAGGTTCCCAAAAAAAATTACAGAGGAGCCAATCCGCACACCGAGTCAAACACTCATAACTCATAGTATCTAGGAGGTCAACAGACTACCTAGACTCTTGGACACTTCAGACAGGCACGTGAGTGAAAAGGTGGCTGACACTTTCGCCGTTGTGTGTACGCCGGATAGCCTAGAGTAGAATTTCACGTCAGAGACCTTGTTGACTCAATGTTGATTCCCGGGTAAAGTTCCGAGATCTTACCTCTGCAATCGTTGCTGAGACATCAATGACACGAATCTTCGGGCATCTGTCAACTTTGTTGCCCAGTGGTACGGTCTGGGGACGCGTGCAAACAACCGTGTTAGCTTTGCCTGTGTGATTCGCACGAGTATTGCTTGTTCCTACGTTTGTAACGACGACCTTGGACAGGCACGAGTTGTTGAGGTTCTCAATGGCGTTTCCGCTCAGAACTGTGGCGAGTTTTTTTGGTCAGCCATCATCAACATCGATCAGAAGTTCACTGCTATCGATAGGCCCTGAGGTGTTCCTAGTAAAACATACTGCCATCTGTTTCAAAAGACTTGTTAGCTATCACAATTCGTGCAGAATCGCCTAAGTGACACTTACGGGTTACAATTGCGACCACCTCTGCTGCGCCGTGGTCCTTCACAGTCTGGGCTGCCTTGCTCAGAGTCCCGCACGTGTCGGCCATGTCGTCGACCTGTCCTATGTTTTAGTAATTCTTCCAAGATCCAGTATTGTGAGGCAATTCGCTATGAGCTTACCAGGATGGCAATTTTGTCCTTGACATCACCAACAAGAACCATACGTCCCACAACATTGGGTCGCGGACGCTCCCTGTCAGCGCCAAGCGCTTACTGTTAGCACTGATGTCGCTCAATGTACAATATTCTAGCATTGTTCCTTAGGGGTTGCTCATACTTGTGAATGAGGGCGAAGCCAAGGTCTAGACGGTCCGCAATGGAGGTAGCCCTCTTTGCTCCTCCAGCGTCAGGCGACACGATGACACACTTCTCGACGGGCAGGTTTTCCCTGATCCAGCGAAGTACAGATGGTTCCTAAACGTGTCAGCTTGGTAGGCGCAGTCAGGCGTTATGCGTGCACTCACAGCGTATAGGTTATCAACAGGTATGTTGAAGAACCCTTGAATTTGAGACGCGTGCTATTCACGGCGGAGAGTTAGCGACCTGTCAAAGCTACATTCGCCCCTGAATTGCAGGGCGGAATCTTCTTACCAAATCCATTGTGATGACATGATTGCAGCCAGCGGTTTGCTGTTGAGCCATTAAATATTAGTCATGCGCATAAAAAAAAAGACATATGCGCTGCCGATAGCCTTTTGCGAAAGTTTCTGAGTCCCTTTGGGTACATGATCAACATACAATCATGTTCCTGTTTTTAATGTTAGAATCCTGCAACAGTAGTTAGTCTCAGGGGACGATGGACTCACGCTATAAGCTTGGCCGAGATAGGGGCTGTAGAGATGGACGTCAGTGCCGATCAAGTTTACAGAGGTTGGTTCAGGTAGAGATGCATACCTCGTGACCTATCCTTCTTGTCTTGGCGAGCTATAGTTCCAAGTTAGGCCTCATAATTTATACTATCATAGACATGCCGTGGAAGCACGAACCATATGCTACATGTAAAGCGTTAGTCATTGTCATCGAACATGACCGGAGGTCTATGCATTTCAAGTATGGGAGCACTCACGGAAGTTGGGAAGAACACTGTAACACAAGAAGGAAGAAAACAGGTTAGTGACTGAAATACATTCGCAACTTGATGCGATAATCATACCAAGTGATTCTCCTTGCTGAAGCAGTACGGCAAGCTATTGAAATATGTTAGTGAAGGGCATATCGACACTAATGGTTAATCGTGATGACTTACCGTGTGTCATAATGAGGAGCTCCATCAAGCCTGGGCTAGTTGTTAGTCCGCAGCGCAACTTTCTAAGCCAGTGTTATCAAAGCCGGCAAGTCGCACCATCGTTTATGTCACCGGGCATGGTTGACTGAATGATGAATACGTCTTCATCGCGAACAGACTCGCCCACAGTGACACTTGTCTCTTGGTTCGAGTAGTTCAAGCTCAAGGTCTTTGCAATCTCGATACCAAGCCTGGGAGAAATTTAGACTGTGTCAGTGACCCCATGGACGGTTTTTTGATACCGTAAAAGGCAAGTAGATGTCTGTGAAAACCTACCTGTCAGCAACTAACCGCCCCAACAGCATGCTGTGAAGGAATATGTCAGCTCATGTCTCATATAAAAAGAGAGGTTATTGTGTATGCACATGTAGGAGATGGTAGTGAGAATATAGTGAAAAATGTAGAGAAACAAAAAAAGAGAGAGAGAAAAAAAAAAAAAAAGAAGAGATCAGAGATATCGCGTACTGAGAGTTGCCGCTAAGCAGCTTGATCGAATTCGACGTCGAAGACATGATGCAGACTTGTCAAGAGATGTCGCACTCGTTACAAGCAATTCGGGACAGGATCAGCGGTTGGTGAGGCGTCGGAAAGATAGAGTTGCGATAGGAAAAAAAAACTACACAAAGCAAAGGCCTAGGCAAGGTATGTTATGTTGTGCATGTAAAGAAATGCCGGCAAGAAGTGCAAAGAGAAAGCAAAGGCTGGGCGGCTTCGAAATTTTGGTGGAGACTGACATTACTCCAAAGTACTTCGAGACCGCCTACCAAAATTGCCCCGCGGTTGCATGCAACTGTCAGGGATCAGGCCCCCAGAAAACACTTCCAGCCTTGCAAGCCCCCAGTACCGACATTGCTTTCTTTCACACCTTGTACGTACCTTACTCCGTACTTGACCTACTCAGGTATTTTCTCCCGCTTTTCATACTCACCTTCTTTTCCCTTTGATATATGCCTAGCAAAAAGATTTGGAATCTCTTACCAATAGACACACGCTCCCATCTGTCTGTGACACTGACTTCTTTGCTCGTCACAATAGTGTTTTTTTTCTCGTGGGGGGAGGTACATGGCTTGGTCCTCGATTGTTTGACACGTGATGGGAAGCTGCACTGATAAGATCCATGACCCACTTTCGATTGGCTACACCGATCAAATTGCCGGTAAAATCTAGACTTTTTTTAACCTTCTGGTCGCTCATCCCACCAACAAAATGGCCTTGGCCACCGCGGTTTTTTCGATATAGCCGTATTTTCTGAGCGATAGGCTTCTTTCCAGCTCAATCACTTGTCGGGGCTGGGTGGGGTCTTCAATCTTTGTTTCTTGTAGACCTGGAAGACGCCCCGACCGCCCAGGCATTCGTCCTTAACTGGTGAACCACAACCTGACCGCCTTTGTCTGGTCCCCCCGCGCCGCCTCCAGAGCCGCTGGCTGCTTGTTCCTCGGTCAATGCGAAACCAAAATCAACGCCCGACGTCACAATGGGCCGCAAACCCAATGCGCTGATACTCCAGTTTTTCGAGCGAGGCCCCAAGCTTGCCGACAACAGCAATCGCTATCCTCACACATGCAAGTCTTGCGGGGAGAACTTTCCCAAGGGCCGCATCGATAGCTTGACGAACCACCTCACGCGGAAATGCCCTGCCATATCCGAGAGCGACCGGGTTAGAGCCTGCTTGACAATTCATGGCTTCAACAAGGCTGCTGTCGAACATACGAGAGCTTCTGTCGCCTCCGCAACAGCGGCGGCGGCGGCCGCCGTCCGCCCGCCCGCCGACATTCAGCAGGACCTAGACCTGGTGCAACGAGACTGGACTGCCCTGGAGACTCTGGCCGAGGTTTCCAGACAGATTGATCTTAGCGAAAAGCACGACGATCGTGGCAACCCCGCAGGCGCATCACTAGCGACAGAGAGCACGCTGCTGGGGCAAGACATCCACGACCAGTTCTTGGCACAGAGCGCTCATCTCGGTTACAAGGATGACCATAGCCTAGCGTTGCCCCAAGAAGCCACAGGTAAGCGCAGGTCTGCGTCGATACTCTCGGTATCATCATATCTAATACTTACCCAAATCTCTCACAGCGCAAGAACAGGCAGCCATACCAGGAGCTACGCTACCAGGAACCACGTTACCAGCAGCTACAGATGCTATCAAGGAAGAACCGACCGCTGAGCAACAGCTCGAGGCACTTATTCAGTCTGCAGAGCAAGCATCACACTCAGCCGCCTTGAGTGTTGCGGCAGCGGCTACAGCAAGGCTTAATCCATCCTTGCTGGATCCACAACTCCGCGAAGATGGTGTTCTTGCGGCTGTTTTACCCACTACAGAAGCCCGTCAGACAGACGAAGCTCTTGAACCTGTCCCGACGGGCCCAAGTCAGCCATGGGGCGAGCTCACACAGAGTGATCTGCTTACCACCGTACCCCTGCGTGTACCAAGCCAGGGCGATAACCCGTTGGTGCCCCAGCTGCTGCATGGTCCAATCAAGGGTGGATTCCGAATGTCCAGCCCGAATGGCGGAAAAGCTCGGCACTCGAGGGCCCGTTTTGACGCAACCCGACGGAAAGAAGTGCAAGAGGTGCGCAAGATTGGTGCCTGTATAAGGTGTAGAATCTTGAGGAAAACCTGCTCCAAAGGCCACCCATGCGACACATGTAGGAAAGTCCTCTCACCTCGCATTTGGAAGTCCGGTTGCGTGCGAACCAAATTCTCGGAGCAGCTCGACCTCTACTCTGCTGGAGTTCAGATAGTGCTCAACCAGCAGAGGCTCAACGACCTGAAAGCCCACGTCAATTTTGCCAACCAAGGAACCACTCTTGAACTGTCCATATTCCCAGAATGCAATTTCCACATATCGGCACAGGCTCTACAGAGCATTGGTGCCAAGGAAAGAACACCAGAGGAGCCAGAGAGGCCGTGGGTGAAGGAGGAGCTGCTTCTCATAGATTCAGAAAAGGAAGACCTGCAGGGCAGCGTGGAGCTGTACATGCGGCAAATTCTTCACGAGTTTGTTGAAAGGGAAAAGTCCCACTTTGCTCGCGTGACCCTAGACACGGCCATCACCCTTGGCCATGAGACCCACGACGAGTTGCTGAAGAAGGCCATCGAACTTTGGGGTCTGGTTGAAATGCTGGATCGAGAAAGGCAGTGGAACATCACTGTCAAGTACGGCGGTCTCGATGGCAGGACTAGAGAAATCAAGGACTCGACTGACCAGGACTGTTTCACGACCATTTGTCTACAACTCACTGCTGCCGCTGAAAGAAAAGCGGCACACACGAGCAAGCAGCTACTTCAGGGTATGCAGCGAGTCTTGCAGGACAGCAAGACAAAGATTGATCACAACATGTTCTTTACCACACTGATTCTCCTCAACTGCGTGGAGAAGACGACCTGGGCTTTTAAAGCGTGGGAACAGGATAGTCTCCAACCAATGTGGCCACTCGAGAAGGCTCCTCACAATTTCACTGGGCAAGGATATGTCTTGGCCGACCTCCTCAAGATGCTGCTTGGCATCCGCAAAGTGCTGCCTAGGACGTTTTGTCGCGAGTCCGATGGAATGCTTGCAACGCACGAAGAAGAGTCAGTTCTCCAGGGCTATTTCCACAACTTGGAACTCAAATGTAAGCCCATCTTTCTTATTCTTACGGTTTTGAATGCTTGTGTGAACGTCCTCGCTAAAATTAATCTTTTTTTTTTCTGTCTCTCTCTTTTAGTCGCCGACCTTCAGGCCAAGCAAGAGCAGCCCATCTTCTCTCCGACAGACTCAAGGTCACTCGAACTCTTGTTTTGTTCCACTCTTCTTCTGCCCGCTGCAGAGTAAAGACCAGCGTTATCGTCTAATAACTAGTCTAGAACTAGTCTTGGGAACAGGAAGCTGTGGCCACCGCAGCACCCGATCTCCACGCCGTCTTGCGTTTATGACCATGCATGAATTCATGACCTTATTGAACATCTTCCCCAAAGTCTTCCAAATGGTGTTGCGGTGTTAATAACTGCGATACAATTGTTTCACGTTTACTTCTGTGGTTTACTGCTGCCGGGCAGCGTTGGGACGGAAAATACTGGAAGGGACGGATGATAAT
TGCCAACTTTTCCTCCATACATCCCCCGATACAAAATCTAGTTAAACGCATTTCCATCATTGCTGACGAGGGTGGACACGCATCGTAGACATTGATTCGG
AAGCTCATCAGTATGAGTTTGGCATGTACTCTCAAAGAGCATCGACGCCGACAAGGATAAGAATGATTTGAGCTTAGCGTCAAGCACTGCATTGCAACAT
CCCCCGACTGCTGAGCCACACCCACTCATCAAAAATATGTTAGGTTTGTAAGCTTTCAAGGCTTTGTCCCACAAGATGAGGTGCAACCGACGAACCGACT
TCGTTTCGCCAAGCCCCAAGGGCAGCAAAATATGAGTCACATTCAAAAAGCCTGTCATCATTTGGGAGTACTACCTAAAATGGACCAGGTGGTTACTGTG
AGATTCAAGCTTATTTGGACTTATCAGTGGATCGCATCTGTCGCCGAGTGACGAGGCAATCTTAAAAAAACCACATGGTCGACGCGGTCAGTGCAGTCAT
TATTAGACCAGAAACAAAAACCCCACAACTCTGGTGTAATCCAGCACGCGATGGTCGCATGTTGCTCGCAAGGGGATTTTTTTTCTTCTTCTTGATGACG
CGGATCAGACAGACATTATCGCGCTGCAGACTCAATCGGGTAGGTGACGCGCCTTTTTCTCGTGCCAAGCCTGTGTAGGTAGGGCTAGATAGGTGACTGA
GATCATGGGCAGCCGGGCCCGCGTCGTCAGTCTTTCCCCGCATCCAATCGGCGCAAAACAACGTTATTCAGCGGAGTGGAAGGAGGTGCGTGGTGAGCCA
AGGGAGCCCAAGCACTACAAGCATACGCTTTCCCCCCTTATATCTGTGTTTTATTGCTGGATCCTAATGCCAACTGGACTTTGACCATCTGGTTTAACTA
TCTGCGTAGGACGTTTCCTACACGTGAAGCAATCACCAGTTTAATTGGAGTTTCCATTATTCGGCTTTTTTTTTGTACATAAAAACTGTATGCGTTCGAC
AGGTCGACGACGCACATCTACCAGTAACATTTGCCACATCCCTCCGTAAGATTTCGCATCAATACATTTCGACAATATGAGAATCTCCGCTGCAGTCCTT
GTCACATTCATGGCTGCTGTCACCACAGCCTCGCCCGTGTCGCAATACGATGTCAGCGGCTGCAAACCCGATACGGGACCCAAATATGACCATCACTCAC
AATAAATTTACCTCGTTTCTAGAATGAGCAGGCACTTGCAGCGGCATCAACACCTGCACCATAGTGAAGGATGGAGCTGTGACCAAGGTTGGTCGATCTT
TTGACTGTATCTTGCCAATGTTCACTTGGATGGGATAACGATGGGACAAATATGGGACAAAGATGGGAAGACGGGCATTGGAGATGCAAAAGGTTGAGAT
TAGAGCAAGTGAGCATGAATACTACAACCATTACGTTTACTTGGACAGAAATATGACTTGAACCGAGCGACGGATTTGGGGCACCTGTACCCCCACAGAA
TATAACTTGTGTATAGCCACAGGATGGTTTATCGAGATCTCGAATACAATCCTCACAAAGTAGAAGTTTCATGGGCTAATTTGTCTCCACTACGTACGTA
CTCACTTACGGATTTCTCTGCTCGAATATTCCTACCAAAAACACCAGTTAGGAACATTTGTTGGCGGTTAGCGGTAGGTGGAGGTAGAAAATCGGGGTAC
TGTCATGGGATTTATGGAAACGAAGATTTCAGAAAGACCATATTTCGCTTTCGGCATAGGGTAGATTAGACCCTATGGCACCCACCTGTAAAGTGGTCCT
GCTGCTCTCATCAATCATGGCCATTTGATGCCTCAAGGAGAATGGTGTCCTGAACAAAAGATAACGGCCAAAGAATTCCCCCAGCATAGGCGGGCAATGT
GAAGTAAATTTGGAGAAAAGGCAAGTAAGTGGTCACAATATACTACATAGCGCTGTGTACACCGCACATAATTTACTGTGTAAGTGCTTCTCCGTGGAAG
GACAAGTGCTACTTGGTCAGCTTCTCTTTCATCAAATGGATGGTAAAAGTTTAATCCGAAACGTATGTCATTGAATAGCAACAATGACCGCAACTTGTAG
CTCAAAGAAGAAAATACATGCAAGGCGGGATGAAGATCATTGGAATTGCGTCCAAGACGGTGTGCTGGACTGACTTGGCTAATTCCTTAACCCCAGGCGG
GAGTTCCTTAAGTGGCTGACGGTGGAGATTGCGTGTAGGTATGCATAGATCGCGATTTTCCGCCTGATGTCCTCAAAGCCTTCCCGCGCCCGAAAGAAAT
GTTTTGGGATCGTCACTTATACAGGGATATGGAGGATGGAGGTAATGTAATGACTTTTTGCTCTGGTGCTTTGGAAGAAGAGTCTGAATGTGAAACCGGG
CTCATGAAATGGCCAGTGTTGCTCAAAGGTGTACTTTAGGGTAGCAGTGACGACAACAATCACGGTGCGGAGGAGAACTTGACGCTGTCAATGTGATCAG
ACAGAAAGTCCAGTGAGTGTTAAGCCTCTGCCAGTCGAGAACTGAAGAGTTGCCTCTGGCCAGTAAACATATACCGTAGTCAAGGTAAACGACATGCACG
TTACCTACGCTACAATAGCTATTTGGAGGATCCTACTGACGCAAGGTAAATTAATAAATGAATGAATGAATGGCTTAGTTAATTGAGCCGCAAAGCCCGA
TTCATCAAAGATGAGTTCCACCTCAAGGTGGGGCATTAGCAAGCATGCGTTCCCTTTTCTCATTGGCTGCAAGCACAGACCATGACTTCTTGGCCTTCGC
GGCGCGGCTGACCAGCAAGACCAGGTCTGGTGGCCGCTGCCTTGCCTGCCTGATGGAACCGACAACGCACTTCGATTTGTCTTTAACCCAAGATACAGAC
TTAACCTGTTCATTTTCAACCCAGCCAACTCATCTGGAGCCTAGTCGCCCATCCCGAATATCTTGGGAAACGCATGTGACTCTGTCGCTGCCATAGTCCG
GCCGATTAAAATCGATCGCCGTCCTCGACGACAAACAGCCACCTCTACGGTCCATCTCGAAGCTCCCCACCTTACCTAGGTACACACGTTACGAACTCCG
CTGCATCTCGAGCAGCCGTAGCAGGCTACCCTGCTTTCGCAAACCCCACAGTAGTACATCCATTCTAGCACCTTTGAAACACCCGCATCTCGTTGTCACT
GGCGACTCGGCCTTTCGCGTTTTCTCGAATCGGCAAACAACTTGCCCCCGCGCTCGGGTTCGGACACCGCGTGCATTCGACCATCAGATTACCGAATACC
GGAGAACAAGAACAACAGATCCCATGATGGCGCCAGCCTCACGGGCACCGCTGGGCGTCGGGTCCGGTCGGGATGATATCGAAGTCACGTACGTACGAAC
CTCCGCGTCGCTCGCGCATGCGTGCCCCGCCTCCGGACCGGCAATGCTCCCAGAAATGAGACCTCCTCCTAACTGGTTCTCACAATAGGTGGAACTATCT
ACAGAATGGAATCACCAGGATCATGAACAACTTACAAGATGGCATGACTATGGAGACGGTAAGCCCGACACCTCGAGAATCTCAATTATGACGGACCTCG
CTAACCGACGTCATCGCTTTAGTACATGGGTATCTATACGTGAGTTTCAAGAGACCCGTTCGACTTAAACAACATAACATACTAATGGTAACCCGCAGCT
CCGTACACAATTTCTGCACCTCACAGAAAGCTCTTGGCTTTTCAAATTCGCCCGGCCCTCCAGCAGCTGCGCACAGAGGAGGTAAGCTAGCCAGAAGCAT
CCGTACGGCGGTGGACAAAATTGGGCTAATGATCTTCAGCGCATCTTCTTGGTGAGGATCTCTACAAGAAGCTTATGAAATACCTGAGCGATCATCTCGA
GGACCTGCTCGTCCAGTCTAAAGCCCATACCGGCGAGGCTTTGCTTAGCTTCTACATAAGAGAGTGGGATAGATACACGACCGCAGCCAAGTACATCCAC
CACCTCTTCCGATACCTCAACCGCCACTGGGTCAAGCGCGAGATTGACGAGGGAAAGAAGCACATTTTTGATGTTTACACACTGCACCTGGTCCAGTGGA
AGAATGTCTTGTTCGACAAGGTTCACGAGAAGGTGATGGATGCCGTCCTTGCTTTGGTCGAGAGGCAACGAAACGGAGAGACCATAGAGTATGGTCAGAT
CAAGCAAATTTTAGACTCCATGGTCTCGTTGGGCCTGGATGAGAACGACGCGTCCAAAACCACGCTGGACTGCTACCGTTTCCACTTCGAGAAGCCTTTT
ATCGCCGCTACGGAAGCATACTACCAAAAGGAGAGCCGCGCGTTCGTCGCGGAGAACACTGTGGTTGAGTACATGAAGAAGGCGGAGGCGCGTTTAGAAG
AGGAGGAGGAGCGAGTCCGAATGTACTTGCATCCCGACATTGCCGTGGCACTCAAGCGCTGCTGCAACACCGCTTTGATCGCAGACCACTCGGCGATTCT
CAGGGACGAATTTCAAGTACTGCTGGATAATGACCGCGAGGATGATATGGCGAGGATGTACAACCTTTTAGCTCGAATCAGTGACGGCCTCGACCCACTG
CGTCAGAAGTTCGAAGCCCACGTGCGACAAGCTGGCCTGACGGCCGTGGCCAAGGTCGCATCTGGCCAGGGCGAGAAGCTGGAGCCCAAAGTGTATGTGG
ATGCGCTGCTCGAAGTCCACACGCAATACCAGGGATTGGTCAAGCGGGCATTCAACGACGAGCCAGAGTTTACACGATCTCTTGACAACGCCTGCCGAGA
ATTTGTCAACCGGAACGACGTTTGCAAGTCCGGATCCAACAAATCCCCTGAGCTGCTTGCCAAATACACGGATGTTCTCCTTCGCAAGAGCGGCAGTGCC
GTCGAGGAGGAGGAGCTGGAGAACACTTTGAGCCAGATAATGACTGTCTTCAAGTACATCGAAGACAAGGATGTCTTCCAAAAGTTCTACTCCCGGATGC
TGGCCCGGCGTCTCGTGCATACCAACTCATCCTCGGATGACGCAGAAACTAGCATGATCAGCAAACTGAAGGAGGCATGTGGCTTCGAGTACACCAACAA
ACTGCAACGCATGTTCCAGGACATGCAGATTTCGAAAGACCTCAACACGGGTTTCCGTGAGCATGCTGAAAAGTCCGAGATGAAGGTTTTGGACTCGCAA
TACGCGATCCTCGGAACTGGCTTTTGGCCACTACAAGTCCCCAATACTGCCTTCAACCCCCCGGCGGTCATATCCGAGGATTGCGAACGGTTCACGCGCT
TCTACAAGAACAAGCACGATGGCAGAAAGCTCACTTGGCTTTGGCAGCTGTGCAAAGGTGAGGTTCGAGCGACCTACTGCAAGCAGAGCAAAGTGCCATA
CACCTTCCAGGTGTCCATGTACCAGATGGCGATTCTTTTGATGTTCAACGACGGCGATCGTCACACGCATGAGGAGATAGCATCTACTACCTCTATGAAC
AGCGAGACCATGGACCCCGTACTAGGCCTCTTGCTGAAAGCCAAGGTCCTTCTGGCAGACAGTGACAAGCCAGGCCCAGGGACCACATACAGCCTGAATT
ACGACTTCAAGAACAAGAAAGTTCGTGTCAACCTGAACATTGGTTTGAAGACAGAGCAGAAGCAGGAAGAGGTGGAGACAAACAAGACAATTGAGGAAGA
CCGAAAGCTTCTTCTCCAGGTGAGTACATATTCACGAGTTTCTCTGGTTGCGTGCGAATATCTGTTTATGATGCTGACATTAAGCTATTTCGTGACAGTC
GGCCATTGTGCGTATTATGAAGGCTCGTAAGCGTATGAAGCACAACCAGCTGGTTAGCGAGACCATCGGTCAGATCAAGGGACGGTTTGTGCCCAAGATT
CCGGACATCAAGAAGTGCATTGAGATTCTTTTGGACAAAGAATACCTAGAGCGTCTGGAGGATGATGATCTCGGCTACCTGGCCTGATCGAAGCGAGGGA
CCATGGAAGCTTTGCGGGCAGCACTAGTAACTGATGCTATCACAAGGATTCGACAAGAATCCAGTTTTTAGTGGATGCTCGCTCGCTTGGGATCTTGTTA
CGATTGAAGGTTCTGTGATACAAGCAATGCATGGGTATGAAATCGATGAGGATATGGGATCATGGCAAGGAAGCCAGGACGTTACGGAGGCCAGGAACAT
CTTTCTGGGCGGAACATACACTCGCAATCAGCATTGCAAATTTGTACTTGAATACCCAAAATTGCTACACTTGTGGCTGTTACTTTGAGGTGGCTGTTAC
TCGTACCGAGTATCAATATTTGTCTTCCCCTGAGTCTTTTCGTCGTGACTCCACTAACGTTGGAGGGATGAGGCTTCATGGTGGAGGAGGAGTAGGATTG
GAGGCAGGGCGACTGTAATTGCATTGTCTTCATGCGAATTGCTTGACTTACATTCGACAGTGTGATTCGGGACCATTTTCATGCAGTGAAGTGTCCCAGT
TAGCGGTTATATATGCTCCACGCAGTTCGCGTCCGCACCGGCTATCTTTTAGCGGTGAAACTCAAATTATAAGGACATGTGATATACCGATATTTGGAGA
TCTTCAAACAGGTGGATTAGTAGGTAGGTTTGAGCGTTTCTGTGGCTATATTGGGTGGCCCCAGAGTGACTGCTACGTGGTAATTATTGGAATTGACTGT
TTGACAAGTGCTCCCCCCCCCCCCCCCTTTTTTTTCCCTTCTTCTTTTTTTTGTCTTCTCTTCCTCACCCTTGAATAGAAGAGTTAGTCAGTCGTGCATG
GATGATCCAGGTTGATTAGCTACCGTAGAAGCTGAAGAACGTGAAGGCGAAATTGAGAAGAAATCAAATAAAGCCTCGTATACGGATGATACCTACCTAC
TCAAGTACCGGGCAGCTACTTCGTACTTTTTGCGTAGCCATTGGTGTTCTATCTCGCTTGAGCTTCGTATCTACAGTGTTGCTCTGAGTCTACTACAGGT
CTAGACCAAACACCCACAGATGCCAAGGGCTTTTTTGTCAAGGACATACATGGTACTGCACAGGTGCACAACTGAACATACCCCATTAAACGCTTAGCAT
CCCCAAGTTCATGGTTTTTCTACCGACAAAAGGCCAAGAACTCTTTGCCTTGGCTTTTCCCTAAAGCTTGGCGTTTGATCAGACCCTGCGAGGTCTCATA
ATGAGTTATTTACCGAAACATGTTCGTGCGGACTTGCCTTTCAAGTGAAAAATGCTACGTTATTTCGCTTCGCTTCTTGCCAGAAATGCCAGGGGATTCT
CCGCAATCGTCGTCTATGGAGGAGGGGGGGGCGCCTCTTTTTTTTGGCACATAGGTGGGGCGGCGCGACTCCGTAGTCTCCGTCTGCTTGTAAGGAAAAA
AAAGATAAACATAAAAATAAAAATAAAATAGAGAACGGGGCAATTAATGCCGTGGGCTTATGGGGACAGAGGACATCCGGAAGTTCGAGTCTGAACCCAG
GGAAGAATGGGCCTGAGACGAACAATGACCTTTCTTCTCGTTAGCACATCTGTCATGTCGTTTTTGGGGGGAGGACGGTCCCCTCCCGACTCTGAATCCG
ACTGCCCGTGTGCCAACGATTGATGGATGAGCAACGACGGGATGGGCATGCCATGTCAGCTATGAAAGAAAAAAAAAGACTTTCATGCACCACCAACCCC
CAAATGCACCCACTTTGTCATTACATGTTGTACATTATGGTGGGGAGGGGAGCTGGTAAGCAAACATGCGCGTGGCATCAATGGCACATCGCATAGAAAA
AAAAAAACATACAAAAGTTCGCAATCATCTATCCACACAAAGCGCGTCGTGGGGGCTTGGAGCCAGACGAGAGGTCAGCATCGCCAGCTGCAGGGACTTT
TTGCGGTGTGTGTGTGTGTGTGCGCCACGCGACGCAGCTTGTGCCTGTGTTCAAATTCGTGCCTGGTGTTGTTAGCAAAATGGCCTGGTCCAGGCCCTTT
GGATTGTCAAAAGCTTGACCTTTCCTGATTTGGAAATTACAGCACAAAGGGAACAAAAGATTCGCCCAAGCCCCCTCCCCCCTGCGCCTAGGGGACCACA
CTTGCACACATCACACCCACCAACGGGAGGCTTGTCAATCGGACTCGGCGGGTTGTCCCAGAGCTTGGCGATGGGTGCTGATCTAAAAAAAAATCTCGGC
GCAGTCAGATTCCGATAATCCTGTGCCATTCTCAGGGCTGTCGGTATGTCATCTGGCTGGCTAGTGCAGCTGGCGATTTGAAGGAATGGCAATCGACGCT
TTAGACATCATCATTCTTTGATGTAGAATTTTTTATACTTGTGGTTTTCTTCTTGTCCACTCGGGAATTTTAATCGCTCTCATTTCCTGCTCAAGGTACA
GTGGGCTTGCATTTGTGCGTTATGTTCTGCATACCCGAAAGTAGTTCCGAGGTACCTAATTTTCTTATGTGTCTACGGAGTAATCTTCATCATCTAATTT
CCAGGGTACCTTAGAAGCTTCCTATATTGCTTCTGTTGTCTTTTTCTCAATGCGCTGCTGAAATGTCTCGGTGCCAGCCAGCCTGCCTACGCCTCAGCAA
TGCCAGAATTCTGGACCTTTGTGTTCTGCGCACTCGCCTCGAATCCAAATTTGGCGCTGCCCAAAAAGCTTAGCTTCAAGGCTACCGAGTTATGGCCAAG
GATCAAGGCCTGTGGACCCACAACATTGAGTTCCTTGCTGTGGTCCACCGAGCGAACCCATGTTTCTGGGGGTTCAGTCGGGGGGGCCGGCATGTTTTCC
CCTTTGTTTGTCTTACCCCCCCAACCATTTCCCTATCCGACGAAACCAGTTTTTTCTCTCTCTTGCACCGGCTCGTTTTCTTCGCGCTGGTCGAAACGGT
CGCCATGACTATTGATTTCCAACCGTCAATCTGCGGCTTGTTCCCTAAACTTGACGATTCCGATAGTTGCAGTTCGTCAAATCTCCTCGGGGCTCCCTTT
ATCAAAATCAGGAAATGCGGCAAAGCGGCATCATGGCAGCAAGTGCCGCCAACAACTGTCACCGTGCCTGCCCTATCGGGTCGAAGAGTATGGCCGTCCG
CAAGCCCACGAGAATGGGCTAGGCGTCTTAGGTTTTCTTCTTCTTCTTATTTCTTAGTTTGCATGTTTGTGGAAGTTCCACAGATCTCGGGCGGCTCGTT
GGATGCTCAATACCCAGGCAGTCACATTAGTTTCCGAACCACCATACCATACATCCATTACATACACATGTAATACTCACTCTTGATTTTATGCTTCTAC
CCACGAGGACACAAACGCGCGAGCGAACCAATTCGGTTCACTCGGGCATCATAACCCACACACTCCACATCACTAGACCTGCCAGTGTCACATCTTTGGT
GAATAAACGCTGAAGTTGCTCGGGCCCGTCAAAGCTGAAGCGGGTTCGAAAGCTATCTGCAGCGGCTGCGCCCACTGGCCCTGCTAACTTGGGTCAGCAC
TACGGATCCACAACCGTCGAACCCTGTGGCCTGCCAGACACGCACACCCACCTCCCGTCTCGACCACCCCAGGGGGGTGCACCCCTGCTTGCGCCACTGT
TCTAGATTTCTGTTCCTGGATTCATATACCCCGTCCGCCCCAGATGAGAGGGCTACCGTTACAATGGCCTTGCCTCAGTTCTACGCACATTGTCTTCTTG
GGCTTCTCCATGGCTCTCATACATATTTTTTTTCTCTTGTCGAGCCTGGTGAGCTTAGCCCAACAAGCTGAACTCGCCGACTATGTCTTCACAAATACCG
GTTCCGAGGGCGGAGGGAACACTTTCCCTGGCGTGTCGGAGCCCTTCGGTATGGTGAAGCTTGGCCCTGATGTCTTCCAAGACAGGGTTGATAGCTACTC
GGGCTACTTGCCCAATGGAAAAATAAAGGCATTCAGCATGCTTCACCTCAGCGGCACCGGTGGAGCTCCCAAGTATGGTGTCGTGGCTCAGATGCCAGTG
GTAGGGAATATTGCCAACCCACTCGACGACTACCTAGCAGCACGAGATGCGCCCGATATGACCGAGGTTGGCTACTACAAGTCACGCCTAGCGACAGGGA
TCACGGTAGAACTTGCAGCCTCTTCTAGGGCTGGCATGCTTCAGTACACTTTTCCTTCCGGTCCGACCCCGCGGAATGTTATCGTCGACGTCTCGCACGT
TCTTCCCTCATATAGAGGACAGGGACTAGGCCAGAGGTATCTTGGTGGCAGCATCAGCGTGGATAGGGACGACTCAGGAAATGTGCAATATAAAGGATCT
GGCTCATACGACAACGGATGGAATCGAGCTCCCAAGTGGACCGTCTATTTTTGCGGCGCCTTCAACTCTTCTGCTACCTTCAAGACGTTTGTAGGCACCA
ACGCCACCGCCAACACCTTGTCCAAGTTCTCGAATGACAACAAGGTTGAATCGCTAAGCCGCCTGGGAGCTGTCTTCACTTTTGACGCCGCCAACGTGGT
CTCGCGCGTTGGTGTTTCGTTCATATCAGAGGATCAGGCATGCACGAACCTGGATCAGCAGATTCCCGAAAGCACGTCGATCTCACAACTGCGACAGAAA
ACAAGGGATGTCTGGAACACTGATGTCCTCTCTAGAGTGGCTTCCAACGATAAAAACACGACCAAGTTGCAGCATCTGTACACCTCTATGTACTTCATGC
ATCTGATGCCGATCAACAAAACCGGAGAGAACCCAGAGTGGAAATCGACCGAGCCATACTACGATGATATATTCACCCTTTGGGATCTG
GTAAGTCCAGC
CGGACCTGGGCGAAACAAAGCACGTTTACTGACAACTCCTGTAG
TTTCGCTGCACCACCGCTCTTCTCCATGTATTTCAGCCCAAAGTCTACGAGGAGTT
CATTCGATCTTTGATTGACACTTGGCGCCACGAGGGTTACTTGCCTGATGCTCGGTCTTCTTTTTTCAATGGTGCGACACAGGGCGGAAGCAACGCGGAC
ACAGTTCTCGCCGACGCTTATGTCAAGGGCGTCCGTGGGCAGATTAACTGGGAAGATGGGTTTGCCGCCATGGTCAAAGACGCCGAGGTTGTCCCGGCTT
TGAATGACGACCCTCGCGACAAGACAGGTTCAACGAAGGAAGGAAGAGGAGCGTTGCCCGATTGGAAAGAACGAGGATTTCTCTCTACCAAGTTTGAGAG
ATCTGTGAGCCGCGCAGTAGAGTATTCCCAAAATGATTTTGGCCTTTCACAGGTCGCCAAGGGCTTGGGAAAGACGGCCGAGGCTGAAAAGTATATGAAG
CGATCGCGACAATGGAGGAGCCATTGGAATAAGGACATGAAGGCCCTTGGATTCTCTGGCTTCCTTGGACCAAAGGGCGAAGATGGGCAATTCGAAGAGC
AGGACCCCTTGAACTGTCGCGGCTGCTACTGGGGTGACAACT
GTAAGCCATGAATATTCCTAAACACTTGCAAGTGTGACTGGTCGCTAACATCAAACAG
ACTACGAAGCACTGCCATGGGAGTACACCTTTGGGCCCCATCACGACATCAGCACCTTGATCGACTACTCGGGAGGTCCTCGGAGATTTGCAAGCCGCCT
TCAGTGGACTTTCGAGCCTAATGTCCGCCCCAAGGGCCACGAGAGATTCAACAGGATGATATTTGACCCCGGCAATGAGCCAAGCTTCACAACCCCCTAT
CTTTACAACTTCGTGGGTCGTCAGGATATGACGGTCAACACCACACGCTACCTCGGAAAGACCTACTATGGTGTTCGTCCGAACGGCTTGCCGGGCAACA
GTGATGCCGGCGCCATGGAATCGTGGATTCTTTGGGTAATGCTAGGTCTTTACCCCATGACAGGCCAGACCACCTTCCTCATCGGCTCACCTTGGCTTGA
CGATATCACAATTTCGTTGGGTGACGGAAAGTCCCTTCAAATCACCTCCACAGGCGGCTCTGAGGACTCGTTCTATGTTCAGAGTCTCAAAGTCAACGGG
AAGAACTGGACAAAAACGTGGGTTACCTGGGACGACATATTTGCCAAAGGCGGAAAGCTCGAGTTCACCCTTGGCCCTGAGCCATCCAACTTTGGTGCTA
CAAGCCCCGAGAGCCCACCACCTCCCAGCCCAGCGAGCGAGTACAAGTCGGGAGAAACGTACATGGGTAACTTAGGTGGCTACACTTCCAACATGAACAG
CGGTGGTCATCCGTCGTGGCTTATTCCTGTGGCTGTTACGGTACCGATAGTCGTTGTGGCGGCATTCGCCATCTGTGTCACTTTCTTCTTCATCCGCAGG
CGCCGTGCAGCCGCGGCACAGAAAGCATTGTCCTCTGGCTCAGGAACTCCGGAATCCGGAATCGAAACTCTTACACCAACGAGTCAACCAGTCGATACTT
CCAAGACAAACGTACAAGTCGAAATTGTGGGCGCACCGCCTCTAGACTCAACCCAAGGCGCCAATATAGCACAGCTACCTCCACCTGTCGCCAACAGGTG
A
ACACACAGCTGTTTTTTTCTGATTTCATCCGCACATATCCAAAAGTTCCGTCTCTGAACATATCCTCCTATTGGGACACGCATTAATTCTCTGTTGCTA
TTTTTTCTTACATTTTGTTGGCAGCGTTAATATCTGGAGATACCCCGAGCAAACTTGGCTCATCTGACACAAGAATATTTGTTTTTTACGACTGCATAGC
TTGGCGCAAGGAGGGATTTTAAAAGAAATCAGAGCATGAGCATTATAGGAATTGCATCAGCGATATACATTATTATTTAGTAAAATATGAAGCGCTCGAT
CCACAAGGATCCTTACCTCGCCCGCTTTGATCCCTTTCTTTCCGATGAATACATGATAATAAGCCCTCTAAAACTTGGGCGTGAGATGCTCTGATGACAC
CGAAACACTACAACCGACGGGTGCGTTTATGACTCAGTTTCTTAAATGTTCTACGTTTAAGAGTGACGGGGCAGCAGTTACACGCTGTTCTTCTCGTCCG
AATGCCCAACCTCAAAACCTCTAGCCAAACGTGCCAATATTCCAGAGGCCTTGGGCAATGCAATGTGGCGAATTAGGCGACATCCCAGTTACCCATGTCG
TCGGCCGCTTCATAGTCCATGTTCTCATCATCATCCCCATCGCTGTCTCGCGGAGAGCCGTGATCCCGGGCGCCGTCATTCATGGCATCGTCGTTACCGT
CTGCCGAATCTCTGGCCTCGGCACCCTGCTGTCCAGGGCTCGGTTTCGAGCTGTTGGCTGCCGTCTCGGCGGCCGAGTTGGGAACCCAGGCCAGCTCGAT
CGGCGCCTCTATGCCGGGTATGCCTTTGCCGCTGCTCAGTCCGTAGTAGAAGGTCTCTGCCGTTCTCCGGTCGCTGAAGGAAACATGCGCCGTGCCACCG
TCCTGCACCTGGATCTCCTTGAACTCACCAACGCCCTACAAAGTAACGAGTATTCCAGTCAGTAAACCGAAGCTAATAAAGAAGACACCAGCAACAGGAA
GAAGATTTTGCGAAGACACGGATGCCAAGCCAAGAACTTACAAGAAGGTACTGCCGGAGGGCCTCGTCCTTGTCCGCCGTCGAGAAATCAACGCCAGACA
CGGCAACCCGCTTGGGTCGATGATCCAACGAGTACATCGCGTATGCAGCGTGGTGGTTACCCCTGCCCCGACCTCGGTATCCTCCCCGAAACCCAGCCCT
CGGCGGATATGAGCTGTAGTGGGGCGCGAAAGGATACCCTCCACGGCCGCGGCCCCTGTACCCACCGCGACCGCGATATGCAGGAGGCCAGGACGACGTT
TCTGTCGATTCCTCTGGGTTGAGACCCATAGACCTTGCCTCTTCCTCTAGGGCTGCCAGAGTTGCACGCAGGGCCCTCGTCTCTTCGCTCTCGGGCTTGG
AAGACGAGCCACCATCCGTAGAGAAAGTGACCTCTGGGGACAAGTCACGATTATGTGACTCGCCAGCGCCCCGAGCGGCAAGCTTGGCCCTGAGCTTCTT
ACGCTCCTCGTGAAGCTCCTTTTGCCGCTGCTCCAAATCCTGGCGCTGGCGATCTAATTCCTCCCTCTTCCGTTTCTTTTCTTCAAATATCTTTTGCGCC
TCCTCCTGCCTGCGTGCAAACTCCTCCGCGTCAACCTCAGGCTCTGCAGCAGAATGTTCTTCGCCTGTATCGGGATTACCGCCGTTTGTTGCATGCGGAA
GTTCAGTGTTGCCTCCACCGGAGGTACCGTTGGTGCCCGCTGGTTTCCCCAGCTGTTCATCGTCGTCCTCCTTGCGCCAAAATACCCTGACAAAGCGATT
GTCAAAGATCACCTTTGGTGACCTATATGCCGCGTTTGCCGATGCCCAGGTATCGTATTCAACCACTGCCAACCTTTTGTAAGGTTGCATGGACACTGAA
ACGATGGTTCCGAACTGGGAAAAGAAACCCCTGACTTCCTCCTCAGTGAAGTTCTCCTCGGGAATGTTCTCAACCACTATGGTAGATCGGCTCTTATCAT
GGACAGGGCCCTCAGCTGAGAGCTGTGAGCGTCTTCCACCTTTGCCCTTGGGCCCTTTTGCCTGGCGATTGTCCATAGGAAACTTGGGCTGACTGCCATT
GAAGGGGAACCCTGGTAGCGGGGGAAGGTTCATTGGCATCATTTTCTGACCATGACCTTGAGGGAGCAACAATGCCGCATTTGCGGGATCATACCCTGCA
AGTAGAGGTCAGCTAACGTTCAAAAACCATCCGACCCTCAAATGATTTCCAACAAAAAAAAAAAAGATTCTGAGGCGCATACCTTCGAATTGGCCCGCTG
GCGGTGGCACCATATCAAAGCCTGTCGGAGGACCATGTTCGAACTTGCACGTGTTACCTCTTGTACAGTAGCCCTGCGCATCGTAGTCCCTGCATCGTCC
TCGTCTGGATCCTTGACCCCTTCCTGATCTCTGAAATCGCGGCGCCATCACGCCGGCGGCTAGCGCTTGCTGCTGTTGTGCCATGAAGGCTTGCATCGAG
TCGAGCATGGCTATCGCGTCGTACTCAAAAGCACCCCCATGCGCTCCGGGAGCCGGCAGGTCAGAGTTTGCCCTCGGGTAGCCATTCTGGCGTCGCGCTT
GCTTGCCCCTCCCTCCACCGTACATGCGATCGCCATTCTCCTGCGATTTTGGATCATCGAAATCACGATATTGTCGTTTGCGCGACGAGTTGCCGCTAGG
GACGGCGAAGGCTGCTGTGGCCGGAGGTGGTGGAGCGGCCGCATAGTATGCCGAGGCTGGGATCTGAGGTGGTGGCGGCGGTTTTGCCTGAGCCGGTGGT
AGCTTGGGGGCCGGGGAAGCACCTGGCAGGAAGGACTTGTATGCGATGGCTGCGAATACGTCGTCGAGGAACACGGTTGATTCTGAGAGCAAAAAGGACC
AGTGTTAGTAATGTCACAAATGGCGGGCGGAACCGACAAGGCACGCATATGGATTGGAGTTCCAGGGCGACAGACCCTCTTTGAGGAAGTCAGGAATCTC
CTCTTCACAAAGCTTTCGAACCTCGTCAGGGCTACCGTCATGACGCAATAGCGCAAGCACATAGTCTGCTAGAACATCGGGGTCGGCATCGGATCTGAAG
CGCGTAAGCGAGGTGGAAGTTATCAGCATTAAGCCATGCGTAATAAGTCAAAGTAATGAATGGAAGGGCTTGCGACGAACGTGTTCTCGAGGCGCTTTAC
GATCCATGCCTTGAGAAGGGCAGCTTCCTCATCCGAAAAGTGCATGGTGAGCGGGATATGATGGGAGAAAAAAGGGCAGCAGCAGCCCACGATTACGGCT
CGTAAGTCATTAATTGATTAATCGTCTGTTTCCCTGGTATCAATTACAAATATCTCGCTATTAAAGGACGAGATTGAAAAGATGTATCGTGGTTGTGGTG
TGTTTCTGACAAGCAGTCGGGACTTTGATTTTCAAAATATTTGCCCTGGCGCGGCCCGCGCCAGGATGAAGTCTTAAGGCTTTCACTGGCCCCACTGAGG
TGCAGATGAAGCGCAGTCAGTACCTTGCCTTAGCTCTCTTAGGTACCCACTTATATTATAAGGTAGTACTTCGGATTAGTGCAACACGGAACCTTCCACA
GAGGAAGGCAGAGACCGGCACTTATCAAGCAGCCAATTCTGTTAGTTAGGTAGGTAGGTAGTAGGTATCTTTAGTAGTCAAAGTGGCCCCATATATTCTG
CGCTCGCACCTGGTATATGTAGGTGACTACCTAGGTACCTACCTTAGGTTGGTAAGTACCAAGCAAGTTAAACGTCTGTCTCGTGTTCATATGCATGGGT
CCCAAAGGTGGCTGGCAACTACTACAGTCAACTGCTTGTTCAGTGGTCCCTTGAACATTAAGCAAACTAAGCCCGGCTTTTTAAGATTGGGAACGTGCGT
CATGAAAGAAACGTATGCAAGGTATCCTGTGATCCAACTGTTTATTCCGAATCCATCCTCGGCCGGCTGTAAGCACTATATGCTACGCCGAAGGTTCCCA
AAAAAAATTACAGAGGAGCCAATCCGCACACCGAGTCAAACACTCATAACTCATAGTATCTAGGAGGTCAACAGACTACCTAGACTCTTGGACACTTCAG
ACAGGCACGTGAGTGAAAAGGTGGCTGACACTTTCGCCGTTGTGTGTACGCCGGATAGCCTAGAGTAGAATTTCACGTCAGAGACCTTGTTGACTCAATG
TTGATTCCCGGGTAAAGTTCCGAGATCTTACCTCTGCAATCGTTGCTGAGACATCAATGACACGAATCTTCGGGCATCTGTCAACTTTGTTGCCCAGTGG
TACGGTCTGGGGACGCGTGCAAACAACCGTGTTAGCTTTGCCTGTGTGATTCGCACGAGTATTGCTTGTTCCTACGTTTGTAACGACGACCTTGGACAGG
CACGAGTTGTTGAGGTTCTCAATGGCGTTTCCGCTCAGAACTGTGGCGAGTTTTTTTGGTCAGCCATCATCAACATCGATCAGAAGTTCACTGCTATCGA
TAGGCCCTGAGGTGTTCCTAGTAAAACATACTGCCATCTGTTTCAAAAGACTTGTTAGCTATCACAATTCGTGCAGAATCGCCTAAGTGACACTTACGGG
TTACAATTGCGACCACCTCTGCTGCGCCGTGGTCCTTCACAGTCTGGGCTGCCTTGCTCAGAGTCCCGCACGTGTCGGCCATGTCGTCGACCTGTCCTAT
GTTTTAGTAATTCTTCCAAGATCCAGTATTGTGAGGCAATTCGCTATGAGCTTACCAGGATGGCAATTTTGTCCTTGACATCACCAACAAGAACCATACG
TCCCACAACATTGGGTCGCGGACGCTCCCTGTCAGCGCCAAGCGCTTACTGTTAGCACTGATGTCGCTCAATGTACAATATTCTAGCATTGTTCCTTAGG
GGTTGCTCATACTTGTGAATGAGGGCGAAGCCAAGGTCTAGACGGTCCGCAATGGAGGTAGCCCTCTTTGCTCCTCCAGCGTCAGGCGACACGATGACAC
ACTTCTCGACGGGCAGGTTTTCCCTGATCCAGCGAAGTACAGATGGTTCCTAAACGTGTCAGCTTGGTAGGCGCAGTCAGGCGTTATGCGTGCACTCACA
GCGTATAGGTTATCAACAGGTATGTTGAAGAACCCTTGAATTTGAGACGCGTGCTATTCACGGCGGAGAGTTAGCGACCTGTCAAAGCTACATTCGCCCC
TGAATTGCAGGGCGGAATCTTCTTACCAAATCCATTGTGATGACATGATTGCAGCCAGCGGTTTGCTGTTGAGCCATTAAATATTAGTCATGCGCATAAA
AAAAAAGACATATGCGCTGCCGATAGCCTTTTGCGAAAGTTTCTGAGTCCCTTTGGGTACATGATCAACATACAATCATGTTCCTGTTTTTAATGTTAGA
ATCCTGCAACAGTAGTTAGTCTCAGGGGACGATGGACTCACGCTATAAGCTTGGCCGAGATAGGGGCTGTAGAGATGGACGTCAGTGCCGATCAAGTTTA
CAGAGGTTGGTTCAGGTAGAGATGCATACCTCGTGACCTATCCTTCTTGTCTTGGCGAGCTATAGTTCCAAGTTAGGCCTCATAATTTATACTATCATAG
ACATGCCGTGGAAGCACGAACCATATGCTACATGTAAAGCGTTAGTCATTGTCATCGAACATGACCGGAGGTCTATGCATTTCAAGTATGGGAGCACTCA
CGGAAGTTGGGAAGAACACTGTAACACAAGAAGGAAGAAAACAGGTTAGTGACTGAAATACATTCGCAACTTGATGCGATAATCATACCAAGTGATTCTC
CTTGCTGAAGCAGTACGGCAAGCTATTGAAATATGTTAGTGAAGGGCATATCGACACTAATGGTTAATCGTGATGACTTACCGTGTGTCATAATGAGGAG
CTCCATCAAGCCTGGGCTAGTTGTTAGTCCGCAGCGCAACTTTCTAAGCCAGTGTTATCAAAGCCGGCAAGTCGCACCATCGTTTATGTCACCGGGCATG
GTTGACTGAATGATGAATACGTCTTCATCGCGAACAGACTCGCCCACAGTGACACTTGTCTCTTGGTTCGAGTAGTTCAAGCTCAAGGTCTTTGCAATCT
CGATACCAAGCCTGGGAGAAATTTAGACTGTGTCAGTGACCCCATGGACGGTTTTTTGATACCGTAAAAGGCAAGTAGATGTCTGTGAAAACCTACCTGT
CAGCAACTAACCGCCCCAACAGCATGCTGTGAAGGAATATGTCAGCTCATGTCTCATATAAAAAGAGAGGTTATTGTGTATGCACATGTAGGAGATGGTA
GTGAGAATATAGTGAAAAATGTAGAGAAACAAAAAAAGAGAGAGAGAAAAAAAAAAAAAAAGAAGAGATCAGAGATATCGCGTACTGAGAGTTGCCGCTA
AGCAGCTTGATCGAATTCGACGTCGAAGACATGATGCAGACTTGTCAAGAGATGTCGCACTCGTTACAAGCAATTCGGGACAGGATCAGCGGTTGGTGAG
GCGTCGGAAAGATAGAGTTGCGATAGGAAAAAAAAACTACACAAAGCAAAGGCCTAGGCAAGGTATGTTATGTTGTGCATGTAAAGAAATGCCGGCAAGA
AGTGCAAAGAGAAAGCAAAGGCTGGGCGGCTTCGAAATTTTGGTGGAGACTGACATTACTCCAAAGTACTTCGAGACCGCCTACCAAAATTGCCCCGCGG
TTGCATGCAACTGTCAGGGATCAGGCCCCCAGAAAACACTTCCAGCCTTGCAAGCCCCCAGTACCGACATTGCTTTCTTTCACACCTTGTACGTACCTTA
CTCCGTACTTGACCTACTCAGGTATTTTCTCCCGCTTTTCATACTCACCTTCTTTTCCCTTTGATATATGCCTAGCAAAAAGATTTGGAATCTCTTACCA
ATAGACACACGCTCCCATCTGTCTGTGACACTGACTTCTTTGCTCGTCACAATAGTGTTTTTTTTCTCGTGGGGGGAGGTACATGGCTTGGTCCTCGATT
GTTTGACACGTGATGGGAAGCTGCACTGATAAGATCCATGACCCACTTTCGATTGGCTACACCGATCAAATTGCCGGTAAAATCTAGACTTTTTTTAACC
TTCTGGTCGCTCATCCCACCAACAAAATGGCCTTGGCCACCGCGGTTTTTTCGATATAGCCGTATTTTCTGAGCGATAGGCTTCTTTCCAGCTCAATCAC
TTGTCGGGGCTGGGTGGGGTCTTCAATCTTTGTTTCTTGTAGACCTGGAAGACGCCCCGACCGCCCAGGCATTCGTCCTTAACTGGTGAACCACAACCTG
ACCGCCTTTGTCTGGTCCCCCCGCGCCGCCTCCAGAGCCGCTGGCTGCTTGTTCCTCGGTCAATGCGAAACCAAAATCAACGCCCGACGTCACAATGGGC
CGCAAACCCAATGCGCTGATACTCCAGTTTTTCGAGCGAGGCCCCAAGCTTGCCGACAACAGCAATCGCTATCCTCACACATGCAAGTCTTGCGGGGAGA
ACTTTCCCAAGGGCCGCATCGATAGCTTGACGAACCACCTCACGCGGAAATGCCCTGCCATATCCGAGAGCGACCGGGTTAGAGCCTGCTTGACAATTCA
TGGCTTCAACAAGGCTGCTGTCGAACATACGAGAGCTTCTGTCGCCTCCGCAACAGCGGCGGCGGCGGCCGCCGTCCGCCCGCCCGCCGACATTCAGCAG
GACCTAGACCTGGTGCAACGAGACTGGACTGCCCTGGAGACTCTGGCCGAGGTTTCCAGACAGATTGATCTTAGCGAAAAGCACGACGATCGTGGCAACC
CCGCAGGCGCATCACTAGCGACAGAGAGCACGCTGCTGGGGCAAGACATCCACGACCAGTTCTTGGCACAGAGCGCTCATCTCGGTTACAAGGATGACCA
TAGCCTAGCGTTGCCCCAAGAAGCCACAGGTAAGCGCAGGTCTGCGTCGATACTCTCGGTATCATCATATCTAATACTTACCCAAATCTCTCACAGCGCA
AGAACAGGCAGCCATACCAGGAGCTACGCTACCAGGAACCACGTTACCAGCAGCTACAGATGCTATCAAGGAAGAACCGACCGCTGAGCAACAGCTCGAG
GCACTTATTCAGTCTGCAGAGCAAGCATCACACTCAGCCGCCTTGAGTGTTGCGGCAGCGGCTACAGCAAGGCTTAATCCATCCTTGCTGGATCCACAAC
TCCGCGAAGATGGTGTTCTTGCGGCTGTTTTACCCACTACAGAAGCCCGTCAGACAGACGAAGCTCTTGAACCTGTCCCGACGGGCCCAAGTCAGCCATG
GGGCGAGCTCACACAGAGTGATCTGCTTACCACCGTACCCCTGCGTGTACCAAGCCAGGGCGATAACCCGTTGGTGCCCCAGCTGCTGCATGGTCCAATC
AAGGGTGGATTCCGAATGTCCAGCCCGAATGGCGGAAAAGCTCGGCACTCGAGGGCCCGTTTTGACGCAACCCGACGGAAAGAAGTGCAAGAGGTGCGCA
AGATTGGTGCCTGTATAAGGTGTAGAATCTTGAGGAAAACCTGCTCCAAAGGCCACCCATGCGACACATGTAGGAAAGTCCTCTCACCTCGCATTTGGAA
GTCCGGTTGCGTGCGAACCAAATTCTCGGAGCAGCTCGACCTCTACTCTGCTGGAGTTCAGATAGTGCTCAACCAGCAGAGGCTCAACGACCTGAAAGCC
CACGTCAATTTTGCCAACCAAGGAACCACTCTTGAACTGTCCATATTCCCAGAATGCAATTTCCACATATCGGCACAGGCTCTACAGAGCATTGGTGCCA
AGGAAAGAACACCAGAGGAGCCAGAGAGGCCGTGGGTGAAGGAGGAGCTGCTTCTCATAGATTCAGAAAAGGAAGACCTGCAGGGCAGCGTGGAGCTGTA
CATGCGGCAAATTCTTCACGAGTTTGTTGAAAGGGAAAAGTCCCACTTTGCTCGCGTGACCCTAGACACGGCCATCACCCTTGGCCATGAGACCCACGAC
GAGTTGCTGAAGAAGGCCATCGAACTTTGGGGTCTGGTTGAAATGCTGGATCGAGAAAGGCAGTGGAACATCACTGTCAAGTACGGCGGTCTCGATGGCA
GGACTAGAGAAATCAAGGACTCGACTGACCAGGACTGTTTCACGACCATTTGTCTACAACTCACTGCTGCCGCTGAAAGAAAAGCGGCACACACGAGCAA
GCAGCTACTTCAGGGTATGCAGCGAGTCTTGCAGGACAGCAAGACAAAGATTGATCACAACATGTTCTTTACCACACTGATTCTCCTCAACTGCGTGGAG
AAGACGACCTGGGCTTTTAAAGCGTGGGAACAGGATAGTCTCCAACCAATGTGGCCACTCGAGAAGGCTCCTCACAATTTCACTGGGCAAGGATATGTCT
TGGCCGACCTCCTCAAGATGCTGCTTGGCATCCGCAAAGTGCTGCCTAGGACGTTTTGTCGCGAGTCCGATGGAATGCTTGCAACGCACGAAGAAGAGTC
AGTTCTCCAGGGCTATTTCCACAACTTGGAACTCAAATGTAAGCCCATCTTTCTTATTCTTACGGTTTTGAATGCTTGTGTGAACGTCCTCGCTAAAATT
AATCTTTTTTTTTTCTGTCTCTCTCTTTTAGTCGCCGACCTTCAGGCCAAGCAAGAGCAGCCCATCTTCTCTCCGACAGACTCAAGGTCACTCGAACTCT
TGTTTTGTTCCACTCTTCTTCTGCCCGCTGCAGAGTAAAGACCAGCGTTATCGTCTAATAACTAGTCTAGAACTAGTCTTGGGAACAGGAAGCTGTGGCC
ACCGCAGCACCCGATCTCCACGCCGTCTTGCGTTTATGACCATGCATGAATTCATGACCTTATTGAACATCTTCCCCAAAGTCTTCCAAATGGTGTTGCG
Copyright 2006 Fungal Plant Pathology Lab. & FBL
E-mail : yonglee@snu.ac.kr
Magnaporthe oryzae ATMT Database