Home   Guide to ATMT Database   Sitemap   Contact  
Sequence ID  5333093
Locus Name  MGG_02943.5
Gene Name  
Protein Name  predicted protein
Species Name  Magnaporthe grisea [Magnaporthe oryzae 5 PROTEINS]
Protein Sequence
[405 aa]
+  1
101
201
301
401

MATRRRRTAVKIPFLMLVCGRKPGTAQIMGIMYELRNSPGKGKGLFASASGVRQGDRIIAEAPILTVDLARFRLPPAELELHLEEKLQSLEADKRADFMSLSTNGADENNPLSSRFLTNALGTDEDDDDDRQGRRQRQRRWQQQQQQQENHQNPHRKAVPAVFRNASRLNHSCVPNCHFSWDRVTRTCLVHAITDVSPGDELTVAYDSRGTAQTTAEMETTMGFRCACPRCSLPSDEVARSNERRRELNAILAEVDLAYRTADPRDQSTEDGEDKEEGEEERYGRQQWDIQPPPSSFAPARILPLCRRIVALQQLEFGGAPTTMTYELGLAMHYASSSCFLHDDYVRASVFAARALAAFTVCEGAEGQNARAYRELTRDLSSTIRSKKPLAGNQQAYDRWLWLPE
LSTNGADENNPLSSRFLTNALGTDEDDDDDRQGRRQRQRRWQQQQQQQENHQNPHRKAVPAVFRNASRLNHSCVPNCHFSWDRVTRTCLVHAITDVSPGD
ELTVAYDSRGTAQTTAEMETTMGFRCACPRCSLPSDEVARSNERRRELNAILAEVDLAYRTADPRDQSTEDGEDKEEGEEERYGRQQWDIQPPPSSFAPA
RILPLCRRIVALQQLEFGGAPTTMTYELGLAMHYASSSCFLHDDYVRASVFAARALAAFTVCEGAEGQNARAYRELTRDLSSTIRSKKPLAGNQQAYDRW

DNA Sequence
[1218 bp]
+   1
101
201
301
401
501
601
701
801
901
1001
1101
1201
ATGGCCACTCGGCGGCGCCGGACCGCCGTCAAAATCCCATTTCTAATGCTTGTGTGTGGACGAAAGCCTGGGACAGCGCAGATCATGGGCATTATGTACGAGCTTCGAAATTCGCCTGGCAAAGGCAAGGGTCTGTTTGCCTCGGCGTCCGGCGTCCGGCAGGGCGATCGCATCATTGCTGAAGCCCCCATCCTCACTGTCGACCTTGCCCGGTTCAGGCTGCCGCCAGCCGAACTCGAGCTGCACCTCGAGGAGAAACTACAGAGTCTGGAAGCCGACAAACGCGCTGATTTTATGTCCCTGTCGACCAACGGCGCCGACGAAAATAACCCGCTGTCCTCCAGGTTCCTCACCAACGCCCTCGGAACCGACGAAGATGACGACGACGACAGGCAGGGACGGCGGCAGCGGCAGCGGCGGTGGCAGCAGCAGCAGCAGCAGCAAGAAAACCATCAAAACCCACACAGAAAAGCAGTTCCCGCCGTATTCCGTAATGCCTCCCGCCTCAACCACTCGTGCGTCCCCAACTGCCACTTTTCGTGGGACCGCGTCACGCGTACCTGTCTAGTCCACGCCATCACAGACGTGTCCCCGGGCGACGAGCTCACCGTCGCCTACGACTCGCGGGGCACCGCCCAGACCACGGCTGAGATGGAAACCACCATGGGGTTCAGGTGTGCGTGCCCTCGCTGCAGCCTACCGTCGGACGAAGTGGCAAGGAGCAACGAGCGTCGGCGGGAGTTGAACGCCATATTGGCCGAAGTGGATTTGGCGTACCGGACGGCGGACCCAAGGGATCAGAGCACAGAGGACGGCGAGGACAAGGAGGAAGGGGAGGAAGAGAGATATGGGCGACAACAGTGGGATATCCAGCCACCACCGTCGTCTTTTGCCCCGGCGCGGATCCTACCGCTGTGTCGCAGGATCGTGGCGCTCCAGCAGCTCGAGTTCGGAGGCGCGCCGACCACAATGACGTACGAGCTGGGCCTGGCAATGCATTACGCCAGCAGCAGCTGCTTCTTGCACGATGACTACGTGCGGGCCTCTGTGTTTGCGGCCCGGGCGCTGGCGGCTTTTACGGTATGCGAGGGTGCCGAGGGACAGAACGCGCGGGCCTATCGCGAGCTGACGCGGGATCTCTCCAGTACCATACGGTCCAAGAAGCCTCTGGCTGGCAACCAGCAGGCGTATGACCGCTGGTTGTGGTTGCCCGAGTAG
AGCTTCGAAATTCGCCTGGCAAAGGCAAGGGTCTGTTTGCCTCGGCGTCCGGCGTCCGGCAGGGCGATCGCATCATTGCTGAAGCCCCCATCCTCACTGT
CGACCTTGCCCGGTTCAGGCTGCCGCCAGCCGAACTCGAGCTGCACCTCGAGGAGAAACTACAGAGTCTGGAAGCCGACAAACGCGCTGATTTTATGTCC
CTGTCGACCAACGGCGCCGACGAAAATAACCCGCTGTCCTCCAGGTTCCTCACCAACGCCCTCGGAACCGACGAAGATGACGACGACGACAGGCAGGGAC
GGCGGCAGCGGCAGCGGCGGTGGCAGCAGCAGCAGCAGCAGCAAGAAAACCATCAAAACCCACACAGAAAAGCAGTTCCCGCCGTATTCCGTAATGCCTC
CCGCCTCAACCACTCGTGCGTCCCCAACTGCCACTTTTCGTGGGACCGCGTCACGCGTACCTGTCTAGTCCACGCCATCACAGACGTGTCCCCGGGCGAC
GAGCTCACCGTCGCCTACGACTCGCGGGGCACCGCCCAGACCACGGCTGAGATGGAAACCACCATGGGGTTCAGGTGTGCGTGCCCTCGCTGCAGCCTAC
CGTCGGACGAAGTGGCAAGGAGCAACGAGCGTCGGCGGGAGTTGAACGCCATATTGGCCGAAGTGGATTTGGCGTACCGGACGGCGGACCCAAGGGATCA
GAGCACAGAGGACGGCGAGGACAAGGAGGAAGGGGAGGAAGAGAGATATGGGCGACAACAGTGGGATATCCAGCCACCACCGTCGTCTTTTGCCCCGGCG
CGGATCCTACCGCTGTGTCGCAGGATCGTGGCGCTCCAGCAGCTCGAGTTCGGAGGCGCGCCGACCACAATGACGTACGAGCTGGGCCTGGCAATGCATT
ACGCCAGCAGCAGCTGCTTCTTGCACGATGACTACGTGCGGGCCTCTGTGTTTGCGGCCCGGGCGCTGGCGGCTTTTACGGTATGCGAGGGTGCCGAGGG
ACAGAACGCGCGGGCCTATCGCGAGCTGACGCGGGATCTCTCCAGTACCATACGGTCCAAGAAGCCTCTGGCTGGCAACCAGCAGGCGTATGACCGCTGG
Position in Contig 849231 ~ 850719 (1489 bp, 271 bp) in Magnaporthe grisea 70-15 supercontig 5.193 (Strand -) (Frame : -1)
Chromosome Chromosome : Not defined!
Contig Sequence
(839201 ~ 860700)

+839201
839301
839401
839501
839601
839701
839801
839901
840001
840101
840201
840301
840401
840501
840601
840701
840801
840901
841001
841101
841201
841301
841401
841501
841601
841701
841801
841901
842001
842101
842201
842301
842401
842501
842601
842701
842801
842901
843001
843101
843201
843301
843401
843501
843601
843701
843801
843901
844001
844101
844201
844301
844401
844501
844601
844701
844801
844901
845001
845101
845201
845301
845401
845501
845601
845701
845801
845901
846001
846101
846201
846301
846401
846501
846601
846701
846801
846901
847001
847101
847201
847301
847401
847501
847601
847701
847801
847901
848001
848101
848201
848301
848401
848501
848601
848701
848801
848901
849001
849101
849201
849301
849401
849501
849601
849701
849801
849901
850001
850101
850201
850301
850401
850501
850601
850701
850801
850901
851001
851101
851201
851301
851401
851501
851601
851701
851801
851901
852001
852101
852201
852301
852401
852501
852601
852701
852801
852901
853001
853101
853201
853301
853401
853501
853601
853701
853801
853901
854001
854101
854201
854301
854401
854501
854601
854701
854801
854901
855001
855101
855201
855301
855401
855501
855601
855701
855801
855901
856001
856101
856201
856301
856401
856501
856601
856701
856801
856901
857001
857101
857201
857301
857401
857501
857601
857701
857801
857901
858001
858101
858201
858301
858401
858501
858601
858701
858801
858901
859001
859101
859201
859301
859401
859501
859601
859701
859801
859901
860001
860101
860201
860301
860401
860501
860601
CTTCGAGGCTCTCCATATCTCCATTTTGAACACGCTGCGTCTGGTCTGCCTGTGCCTTCTTGAGGTCAAAGCTGCTAGCCCGCCTCTGGGGCTTCATTCG
TTGGGGTTGCTTGGCATCGCCATTGGGTTGGTGGGCTTGGCTGGTCTTACCACCCGAAGTGACGAACTGAGCGGCTTTACGGCCTAGGCCGCCTAGGCCC
GTCGATGAGCGGACCTTTTTCTTAATGACACCAAAATCGACATGCTCATGTGACGGGCTCGGCAGTAACGACGTCGCGGCGCGTTCGCTGGGCGCAAGCATGTTGATAGGCGGGGAAGGGGGGCTGTTTGAACGGGTCGTAGCTAGTGAAGTGCCTTCCCTCCTTATTGACCACCGGCGATTTGGTTGCTGAGGCTTCGGCGGCCCATCGGATATCGCAAACTCCGAGCTGGTGCAGGCCGCTTCCGGCTGCTCGATGTTGGGCCTTTCGATTTGGGAGTTGGATCGTCGGAAAGCCTGGCTCATGCGCCGGAGGGGGTTGCGGGAGTTTTTTCTCGAGTGAGTCGGCGGGGTGGCTGAGGGTAATGGCTGATCGGCGTTTGCGGCGGCGTTTGCTGTGTTTATTGGGACTGGGATACTTTTGGTTGCCGATGTGCTCGCCTCAGTGTCGCTGGGTGCAGTTGGAGATCTGACGGTTTTCGTCGAAGTCGGCGAGTGTTCTGACGGTGCCGGTTCGGGGCGGTCTGGAGTTGCAGATGTGCCGAGAATCAAAGGGGTCTTGTTTGTTGGGGCGGCGTCGTTTTGAAGTGAGGAAAAGGCACCAGTCGAGTGTTCGGCAGAGGAGGAGAGCGACGTGGGATGTGTGTCGTGGTTTTGTAAGCTGTGGAAATCTTGGGACTGACGGCCGCTGACTGGAGTAACAGGCTCGTTTGGCGTATCGCTCTCAGACGACTCGTCTTCCTCTTCAAGGATAGAGCTAGTAAGCCCGGTCGGAAATTGGCGTGGCGATGAAGAAAGGCTGTTTTCGCCTTGGGCAGGATCTGATGCTGTAGGGCGAATTGGGGATATAGTGCTGATGCACTTTGAAGGGTGTGATTGGGGTTGCGGTTGTGGCTGTTTTTGTGTTTGCTGCTGTGAAACGCAGGCGTCTTGGGGTGGTGCACCGGATTGCAATTGTTGCTGCTGCTCTAATTGCGGCAGCTGTTGTGCGTTGTTGCTGCTGTTATGAATAGGTTGGGGGGCCGTTGCAAATGTCTGGGACGCTGCACGTAAGGGTGCAGAAGCACCACCAGCTGGTTGTAAAGTTGCCAAGCCGTCCATGGCTGTCAAATAAAGTGAAAGGGCCGAAGTGGGAGGAGTTTAGGCTTCGCAGCTTGGGATCGATGCTTTGCTTTCCTTTCTCTGCTGTAGAAATCAATGAGGGGTGCGTGCCCTTCTGGTCCGGTCCTTGCTTCTAGGTAGGTACTTGTTCCGGAGGACCGACCTCGTGCCAGTGTAAATACGTACACTACGTCAGGGGGCCTGGGGCGCTTGCAAGGTGGTGTATGGTGTAGTGTGTCTGGTCGGGCTATCGGCCGGTCGGGCGGGCAGGCCCTGGGATGGAATGGTGGATTTTACTCAACTGGGTCACCAAGAGAGGAAATCCCAGCCACCAATCCCAGGCAACCAAGCAACAGTAGGGAAAAAAAAAGGGTCGCCGAGAAATGCTGACCGAGTTCGTGATTTATGAATCGGAGAAAGCGAATCCAAAAAAAAATCCCACCATATGCTAGCACGCAATGACCGGGAAAAGGTGATCCCCCTCCTTTTTGTGTTTTGCCTTTTATAATCGTAAACTGACAACCGTATCTCCGGATTGTCTGTCGGAAACCTGATTCAACTTCTTTCTATGCTGATGCACGTGTGGTGGCAATGTCTTTCGCTTGTCGAAGTAATCGAATCTCCAAAGCAAGTTGTTGTAATCATGCCGTCTTCTTGGCCCTTTGAATCTTCTTTCTCGCTCCTTTTTTTCTCCCCTTGTGCTTTTGCGTAGAAAGTCAGGTGCCAAGACTTTTCTCGAGGATGGTGGCTGCAGGTGTCGTGTGCGCCTTGTGCGCCCACCGTCTTGTCAAGTCACGGGCAAGGAGGGCAGATAGGGTATATTATGCGTCGATCGGGATCGGGTATGGATCACCTTGGTTCGTCTATAGATTGGATAGGTTTTCCACTGAGTTAAGTTGGGAGGACTAAAAAGGGAAGTAGAAAGAACAAAAAAGTGATAAATTGATATGGACAAACGAAGCCAAGCTGCTTCTTGTAGAAAGTAAAAGCCGACTGCGGTCCAGGTCGTTCTAAAGGTGGTCGCGGATGCCCCTTTAAGGAGGGGAGCAAAAACAAAGTCGGTCTCGTTTTTACTGCGCTGCCGTGGGGTGGCCCGGAGCTGTGCTTGCTGGTGCGGAAATAGCTCAAATGCGGATGCGGGAGGAGGCGTAGCAGCAAGACATACAAGGCAAGGTTGCAAGGTTGCAGGGTGTGTCGCACCGAATCGTGGTGCCTGCTGGGTCCTAGTTCTTGGTTTCTGGGGTCTTGGTTGCTGGAATAAAAAAAATAATAAAAATAAAAAAAGTCGGCACCGGTCTTCTCCCCAGTCTAAGCTGGTGTCCCAGAGAAGTGCCTTTTCGCCAAGGCACTATCTATATGATAGGTTGACTTGAATAATGCCAATTGTAACGCCAATTGGGGAGATAGCTAGTTCCAGACAGAGCTCGTGGGAAAAAAAGAACAAGTCTGCAACCTTAGGCCGGATCCATCGGGGCCGTCGACGACTATCGTGGCGTATGTTGTGGTTCTCTTCCTGATGACATGCCAAAACCAGACTTGACAGTGTTGGTGTCGCTTCGAGGGATTTTTGTGGATACCTTGGCCCAGGATCTGCAGTCGAGGGCTCGAGGTATCTTGAACCTGACGTTGGATTGGCTGATGGCAAGGTTACCGGGAATAACTTTGAATACTTGAAGGCGAAGAATGATCGAATAGGTGGTAGAAAAAAAATAGTATTAATAAAATAGGCAATGAATGCCACGTGATAGGCTGAACGAGGAACGACCGCTCAAGAACCTTCACGGGGAAGAAGACGAAGGATTAAGAACTTGTCAAAAGGCAAAACTGTGTCCCCTTTCTTCGTATGCTTCTTCTTAACACTCGATAGATATTAAATGCATCAAAATGGGGGAAGTCAGTGTTTTAAAAACACGCAACACAAACAAGTCTGTCCCCGAAAAAAGCCGCGTCCAGTTTCGAAAAGAGCAAGTGGAGGACGAGGGTATGTATCGATATGCGTGCAATGTGTAGCGTAGCAGCACGGCTAGGAAGAAAAGTGGGCAGGAGAATATTACATGGAGAACGAAGTACGGGGGTGTGGTCTCGTAACTCGTAACAATTACTCCCAGTCCGAGAGCCCACCGTCAGTATGCTATGCTGAATTTGTACGTCTGGCTGTCATAACATACTCATACGCTGTTGACAAGCGTTACTCGATTGGCTAATTTTCATGAGACCAAAATGCGAAAGAGTCGGGACGTCCAAGCGAATCAAATACGAGAGGAAAGGGAGAAGAGAGATCACGAAAGGAAGAGAGGAAAAAATAATAATATCAATAATAATAATGATAATAAAAATATCGGCGGCATTCCATTCCCCTATGCAGAATCCCCCCGCGTCAATTAGTACATCACACCGTCGGAAAACCCATCCGCGCTTGTGGGTTTTGCAGATAGGTCCGTCGTCGGCCACATCATATGTAAGGCGGGAGCAAGCACGTACCCAGTACTACCTTGCCTTGGGTCCCGCGCGCCGAGACGCAGGTTGCTAGCACTTTTTTCCCTCTCTCTTTTTTTTTCCTTCCTTTTTTTTCCAATGCGAATTGGCAACTGGGGAGCCCATCCCAATGCCGGCGGTACAACGTCAATTTACAATTATTTGTTAGTCGTTCAGTAATATTACGTTGATTCAGGAACTCCATATAAAGTAGTATAGGCTGGGCAAGCCCAGTGGAGAAGTTCCTTAAATCCTATGACGGTGAGGGGAGGGTGCGACCGCACCGGCAATAGAGCCTCACTTGGCCTTTTGTTTCTACTATTCATTCAACAAAAAGTTTATGCCTGCTCAAGGCGGACAATACCGGTACACCATTGTTTTCATTAATGATGATCATCTTTACAAAGTGCACTGTCTTGTCAATTCACACCGAAGCCTAAAAAGCCTCTCGGCGCGGTAACTTCTTGGCAAATGCAAACAAACTTCTACCGATATTTTTGTCATAGCGAGCAGGGCTGTCCGGCTTGGCTTGACTTGGCTGGGCGTTGTCCATCGAGCTTCCTCTTTCAATGAATGTTGAGTTTGATGTTTCATTTCATGGTCAACATTGTCAAGGTATCCTTTTTGTGCTTTTGGCTTCCAGGGTGTAGGTTGGGATCATCACCGTCTATCGTTGGCAACGGCTTCATTTCCAATATGACCTGCCGAGGCTGAAGCTGTAAATACAAGCTCATGCCGGGGTGAATGAGCCTTTTTTGAACCTTCTTCTTCTTTACATTACTCTCTTCTTCGAATGTCTGACAATTGTCATTTTTTCAGGCTTCCGACTGGCTCGCCTAAAGATTTGTAGCCTGAAGAAAAGTCACAGTTGCGTGCTAGTCTAGTGCAGCAAGGTACTTGCTACGAGAGCAGCGCCAAGTCCTTGACGTGACCCCCGCGGAGGTATGTGCACTTTTGGGGTGGGTAGCGTTGCAGATGGGGTTTGGTGGGGTATCCTGCCCTTCCAAGCCAACTAACGTTTGGTTTGATTCCGCTGTTGCTCCACCGTATTTTTGGTCAGCAGCCACCAACGTGGGAGAACATTTGTACCGGATCTATGGTTCACCTGGGTGAAGTTACAGTTTTGGAATGCACAACAATGCTGTAGACAGTGGCGACGGACAAGACTTGGATATGTAACTAGTCAGCAGGCAAGACAAGATCTGTCTTGGCCGACTTGCTGCTTTGGGATGACGAGATGTCAGTGAAGCCAGTGACCCGGCCAAAAGGCCGACGCGGAAATCAATGGAAGGGTGGATGGTCATGACGGCGCCATGATTGGTTTGTTTCCTCTACCACACCTCTCTTTTTATCCTTCTGGACAATTTCGATTGCGCCCGGAGCTGCAGCGCATCAGAACCAACCAGGTACGGCCCCGATCGATGTGTCAAATCAAGGACAAAAGGTTCAATCAGTCAACCAGTAGTTCGGTATCGGTTCCACTCATGGATGTGATTTATCACCAGACTGTCGACTTGTTGTTCTAAATCCTCAAGTCGTGCCTCATTTGAGGATACATCTAGACTTCCCAGATAGTAATAAACATCAGAGCAATTCATTCGGCTTCGCTGAAGCACGCCAAGACGGTCGTTCACCCTTATTAGGTGCGCGATGGTAAAAAGTCTGCTTGTCCGGTGCCTACTTCGTATTTTTCTCTGGCAATTCTGCGTTAAGGCATGCGCCAAAAATGCCACCAAGGTGCGACGGTAGCATCCAATGATTGTACATTTAGGGGGGGTGGGGGGGGGTCACATTTTCTAATGCCTTCTGTCATGCTCTCGTCGGCCTGAGACGCACGTCTGCCCGCTCACCTACCTTTGGTGGCTCATTTGCCGAGTGCCGAGCGCGATAAGGTAAATGAGCATTATGTGAGCAGAGCAATAAAAATGGATTCATGTTAGCAGGACACGCACGACCGGACAAAATGTGGCTATCACGTAAAGAGTTAGTAGCTGGGTAAGCATCTCGGCCACTGTACCTAGGTACGCAATCTTGGGACCCCATCGCTTCGCTTCCATGATGGGTCAAGTGATATGGGTCTCGACGGAGAAGGGTCCTCTAAAATTGCATCATAGGATCAGGGATCTATGCTTGTTCCGCGTTTCTGTCGTCTCGATTTGCCTACGGTTACCAGCATCCATCGATGAGAAGACGGCGGCAAAATAAATAAGGACGACATGATTTTGTGGTAGATATGGGTATCCATGGATGACGAAGCATCAGGATTGACCGCCAGTTGGCATTAAACATAATTGACCAGGTGCTACTGTTTTAGTTGTATTCATTATGATGTACGTTTTTCCAAGGCATTAACAAATAACAGCCTCAGGTTTACTTAGCAAAAAAGCTCGTACACCCGGAATGTGGGACATTTGTCGCTACTCGGTGTTGAGGGTCTCACTATGTAGAAGGTAGGGGATGAATGGTCTCAAGTTTCCCCATGACGCCATCCCCAGTTTGCGGGGCCCCCATTCCAGCTTTCTATCTCCGGCTTCTTGCTTCCTCCCAACAAACAAACAAAAAATGAGAGCCATGGTTTACCTCGGAGCGCCACTGCCCGAATGTACGGCCTACAGTTCAAACCCCGTGTCGAGGTCGTCAGAGAATGGAAGAAGATTGTGTATTGCAGGGTCGTGACCCCCCCTTATTGTCCCGGGTTTTCCTAATCTAACAAGCACTTCAGAGTCTCTGACTTGTGTCAATAATATGGATTGATAGTGGCGGAATGGGATGCCCGAACAAGTCAGGGTAATTCCATGTAAGCTCCTAATGCAAATGTGCATTTACGAAAAAGCAACAAGTGAGCATCTGAGGCGAGCGAGAGAAAAAAACAACAGGTTGAGTGTTACCCCCACCTTGACTTGCATTCAATAGGCGCTATTGCGCAACAGGATCAGGGTCTATCCCTGATGGATACCAGCAAAAGACGATGACAGCGGAAATTTGACCACTTTTTCTTTTAGCCATGCGGGTCCGAATCGCCCTATCATCAAAGGAGACACGATATCGAATCGTTCCCGATTAAGACCCGTGCAACCCCGTTGCAGCCTTCTCACGATTGATGTCTACTCCGTACAGTATCTCCTGCATTTCTTTCTGAATGACTCGTAAATCCCCAGCCTTGGCCGACCTCTCTGAAGGAGACTATGCCCGTCTTACTCCCTCCCCCTTATTGTCTCCTTGACCGCTCATTACTGCACAAAGGGCCACAGAAAATTTCCGGGCTCATCTCGGCCGATCTTGGGGGCTCTGTTCTGTTTAGCCGCCCGCAACGGGCCTCCAAGGATCTTTTTGGGGTGTGTGTGACAGACAATAGGGCATGTACTAACGCCCGTATCCGACCGAAGGTTCATCTGAGCCCGGCAGTTCTGGGTAAACTTTAACACTGCCAAGAATAGAGAAGTAAACTGTAAACAAGACAACAACAAAAAAAAAGTTGCCGATCTTTTTTCTTTCGTTGTTGCAGAACTGCGGGAGCTAGCTACGGGAGCAGAGTTTCTAAAGTGTTTCTAAGACTTCTAACAAATTGGGTTTTTGTGGCTTTGGAAAGAGAGTTCAGCCACTGGTTCTTGGCGGGACTCAGAACATAATTCCCGGTGGTAAACCAGCAGACCAGTAGTCATTTACCTTTTCTTCTTGATCAGATCACGCTACACCACTTGCATGCGAACGCCCATTTTTCTCTTGGCACTACGCAGGGCACACACATACGCATCAAACTGCCGGAGGCTGTGAAGCAGATCTTGTCTTTATTATGGAGCTAATATGGTGCTAGTCTGTTGTCTTTGTATCCTCAAAATTGAGATGGATAAATGGTAATTATACAGCCACTCCGAAAGAAAAAATAAAGGAACACAATATGCCAAGACGCTGTGGGTTGTCAATGCCCGTCGAGCCGGCTTTCTTGGCATACATAAGGTATGGCATAGCCTCCCCGAGCGGCTCAAGAGCCGGCGATGTCAAGGTGTGAACCACATTCTGGCTTTCTTGGCACTCGGTGGTGTTATGCTTGTTTTTCATGCCTCATTTTTTTGTATCTTAGTTTCTCGAGACACAGCACAAAGGAGGTGCCGGCACAAATAGGCGGTACCTTACCTCCGATCGAAATCAGATTACCAGTACCCTGAACCACCCACCTGCTTGGTTTTTCTTCCTTGTCTAGATCGGTTATCTGCCAGTTCATCTCAACTTTTTTACTTTGACACGTTGTGTCGACTTTGTCGCTTCAATCGTAACCCGTCCCGTCGCATGGATCAAGAATACAAAAATAGTCACTGCATGACTGGTCACGAACAAGATAGATCAGTCAGCCAACACCAATTGATCCGATGGTTGGAGGATCACCCACGTTGACGTCCTAAAGGGATTTATTCTGGTTGGTTGTCATTGTCGGGACGTAGGACACTAATTGGCTGCACCTTTCGTTTATCGAGTAGAGCCAAATTCATGTCCAACCGAGATTGCACTGGCACTCTCTACTTTAGTTGTCTGACACGAAGAGACCTGTGCAGTCCCAAAACTGGCAGCAAACTTTACAGAGATACCCAAGCATGCAAGGCTGGGAGATCCTCCGAGTTTTGATGCTGGTTTGAGCCCTGCAACCAAATCATTCCCTCGATTACTTTTACTATGTATCAACTGCCTATTCTTATCTTTCAGAGTGCCATGCGAAGGCTCAGCGTACTGGGACAGGCGTTCCGCTATGTCTTGTTATAAAAAGAGTAAACAATCATGGCATAGCTAAACCTCGAATGGCGATCATATTACGATCCTATATACGCTGACAATACCTATCCTGGTATGTAACGCGCACACTCACCTCATGTCTAAGTAGTACGAGTCTTACAACTTGAGGCGTGATGTCTGTTGCATGGTTTCATTCGCAGCCATCGCACTGATATTGTTCAGACGATTGTGTGGGGTTGAGAAAGATGAGCCTAAAGTCGAGCGGCTCTTGGACCAATTGCATTCTCGCCGACTGCAGCTGCGGTGCTGTAAGACCACATATGCACAACTCATGGAGAACATGAAAAGGGTTTCAGGGTCGGCCATCGATCTGGGAAAAACAAAGCATCGAGACCTGCTCCTATGGCGACTGACGGCAGCAATAGCACTTGCTTGACTTGCGGCGGATTGAGAGGTGACAGGGTGACAGGGTGGCAGTGTGATGACCCCCCTGCTACCAAACAACCGTTCGGATTCGGAATCGACTACATTGTGTGTTTGTTCTCTGCGCGTAAGATGACTCGCCTTCTGGTAGTAGAAACTCAAATTCAACAATAATCAGCATCATTCTATCCCAGACGACCAAAAGCAAGAGAGGCTGGCGGTATTCAGATCTCCGATCTTCCACAGGCACTAATGGGCTCTCCCATACCGTTGAAGCCAGCTTTGGCTCTGGCAACACAAAAAAATTCCCCGAGTGGCAAAAAGGCGTTTCTTGCACCACATGGCAAGATTGTAGGCTGGCCGTCTCGGGATGCAGCCTTGAACAAGCGAGTGTACACCGCGTCCTCCGCATGCATACTGGACGCAACATAGAGAAATTGACAATAAAGGATGCTCGTTTGGGAGATACACAGCAGCAGGGTCTCCACGGTGGGTAGGAAGACTTGTCACGCTAAATGGCACTTGGCCACACGTGGGCATTTAGAGTCTGTAAGAAGCAGAGGTATAGCCAGTTTCTCCTCATTCGCCTAACAGGTCAGGGCGTAGCAAACTCAAGTCAATTGAAAGGGGATGTGGCTTGTATGTAATGTTAATAGCTTGGTGGAATTAGTCTCGAGTGTCTCCAGGTGCGGTGTCTTCGCATCGGTTTCTCCATGTCATCCTTACATTCGCTGAATCTCGCACAAGGGGTAGTAGCCACCTATCGACTTGTTGGGAATCAGGGTATCTCTTTCTTCACACAGCACTGCCAGTGATGATGCTGACCAGGGCCAGCTGGACACTGGGCAGAAAGGACTCAAGGCCGCCCACGGCGAGAACGCCAATGCACGGCGAGAGTGTGCCTTCCTAACCGGTCCCTACGGCACAGCTCAAGTCAGGAAGCGACGACTGCTGCACAAAAACGTTTGTTCTACGAGAAACTCACTCGGGTTTCTTTCTGTGTCTTTTCCCTCCCCTTTTTCATTCCATCCTTTCTTCGACCTTTTCTCTCTCTATTTGATCCAATCGTAACCCAAGGCTCTCGCCTCTCCTACCATTTGCAGACACCTACTCGGGCAACCACAACCAGCGGTCATACGCCTGCTGGTTGCCAGCCAGAGGCTTCTTGGACCGTATGGTACTGGAGAGATCCCGCGTCAGCTCGCGATAGGCCCGCGCGTTCTGTCCCTCGGCACCCTCGCATACCGTAAAAGCCGCCAGCGCCCGGGCCGCAAACACAGAGGCCCGCACGTAGTCATCGTGCAAGAAGCAGCTGCTGCTGGCGTAATGCATTGCCAGGCCCAGCTCGTACGTCATTGTGGTCGGCGCGCCTCCGAACTCGAGCTGCTGGAGCGCCACGATCCTGCGACACAGCGGTAGGATCCGCGCCGGGGCAAAAGACGACGGTGGTGGCTGGATATCCCACTGTTGTCGCCCATATCTCTCTTCCTCCCCTTCCTCCTTGTCCTCGCCGTCCTCTGTGCTCTGATCCCTTGGGTCCGCCGTCCGGTACGCCAAATCCACTTCGGCCAATATGGCGTTCAACTCCCGCCGACGCTCGTTGCTCCTTGCCACTTCGTCCGACGGTAGGCTGCAGCGAGGGCACGCACACCTGAACCCCATGGTGGTTTCCATCTCAGCCGTGGTCTGGGCGGTGCCCCGCGAGTCGTAGGCGACGGTGAGCTCGTCGCCCGGGGACACGTCTGTGATGGCGTGGACTAGACAGGTACGCGTGACGCGGTCCCACGAAAAGTGGCAGTTGGGGACGCACGAGTGGTTGAGGCGGGAGGCATTACGGAATACGGCGGGAACTGCTTTTCTGTGTGGGTTTTGATGGTTTTCTTGCTGCTGCTGCTGCTGCTGCCACCGCCGCTGCCGCTGCCGCCGTCCCTGCCTGTCGTCGTCGTCATCTTCGTCGGTTCCGAGGGCGTTGGTGAGGAACCTGGAGGACAGCGGGTTATTTTCGTCGGCGCCGTTGGTCGACAGGGACATAAAATCAGCGCGTTTGTCGGCTTCCAGACTCTGTAGTTTCTCCTCGAGGTGCAGCTCGAGTTCGGCTGGCGGCAGCCTGAACCGGGCAAGGTCGACAGTGAGGATGGGGGCTTCAGCAATGATGCGATCGCCCTGCCGGACGCCGGACGCCGAGGCAAACAGACCCTTGCCTTTGCCAGGCGAATTTCGAAGCTCGTACATAATGCCCATGATCTGCGCTGTCCTATGTTTTGTTTTGAGACGTGACACAGATCTCACCGCTTGGGCCTCCGACGAGGGCAGTGGGGGAAACAGGAGAATGGGTTCGCAAAAGAAGGTGAGTACATTTGCGAGGTTTGTGCTGGCTATCCAGTGGATAATGTTCAAGCAGTTGTAGGTTGCAGACTATAAGCAAAGCAATGCATAGTCATTTCTGGGCGACGGGAAGTGGACCGAACCAACCCAAGGGAAAGAGATACATTGCACTTGTTTTAGTTGTGTTACCTTATACCTACCCAGGCTTTCGTCCACACACAAGCATTAGAAATGGGATTTTGACGGCGGTCCGGCGCCGCCGAGTGGCCATTGTTTGGCTGTCTTTTGCCCATGCAGGGAGACCGGTGAGATTAGAGGATTCGATGGGCTTTTTGGGCAGTATGATTTTCAGCTTTGCATGGGGGAATTACTCTCTCGAAAACCCATCCCCTTGTCACTGTATACGAATGGAGTGGACAAAAACCTGACCAGTCTCACCGAGAGCCAGGGGGGGTGCAAGTAATCCCTTCTTGGACTGTGGTACCGGTACGCTGTGATACGAAGGTACGCCAAGTCTGCCTAGGTCCCCGGGCCGTTCAATTTTACGTACCCTGTCAGGCCCTGTACGTATTTTTAGGGGGTGAATAAACAGGAGGGTTGTTAGGTTTGTAGCAAGGTTTCTTCTCACTTAAATCCTAGCAATATACAGAGCGTACAGAGTACTACGTGGTATTTCATATTCACAGCGAAAAAAAAGTTCCGTTCGTTTCCAGGTTTCTGTTTGGTTGCAGTCCCAGGGGCGCTGCACGAGAGTGTGGCAGGACCACGCCTCATCAACGTCACAATGTCGAGTCCATCCCGGATACCGGGATCACCGTATCACATAAATCCATTACCGATTTTTTATTTTGTCTTGGCTGTTCGGCAAATGATTTTGTGGACAAAAAGCCGCCGACTCCAAAACTCATATATGGACCCTGGTTTTGCTTTTGATGTTTTTGAACTCTGGTCTTATTCGCTCGTCATATTCTATAATCTGCATCGATAACGCCTTTTGGGCATCTTTGACTTTGACGTTGGGCTGAGACGTTGCCTATCTTCTTTAAAAAGTACTATTTATTGAAGTCAGGATATTCTTTATTATTCAATATCTCCCGGGTTTTCCTATCAGTCATCAAAATTTATACGCGTGGGAGCAGTTACTCCCAAGGTACGGAGTATACCTCTCCGCCTCTTTCGCCTTGTGTACACATCCAAACCTGCCAAATATGGGTGATCATGAGCTCGGAACAAATCTTGTTAGTCTGGCTTGCTCGGTGGTTTTGTTTTTCTTAATTTACTCCGTACACGGCACAATGGACGCCTCCCGGCGCTTCTGCTCCGTAGCTTTTCTGCTTTCTTGTCCGTCGTTCAATTCATTTTTCTTCTTTGAAAAATGAGAGCTATCCGGCTCACCTCCTCGAGGAGTCGCAGCTGATGGGAGAAAATTTTGTGTGTTTTATTTCTTCTCCAACTGCATCCAACGTCGCACAACATGAGAACAACAAAAAAAAACCAGATTAGTGAACAGGCGCCTGCCGGCATGTCTGTTTTTTTTCTCTGTGCCAGAACCACCAGATACAGGTTCCCACGTCCTTCCAACCAGCGTGTTTTTGCGCCGCTGATGTCTATTAAAGTCGAGGGATGAGTTCCTGTCTCAAAACATAGGCGGTAAAGTGGACGAAAAAAAAAAAAAAAAAGCCAACCAATCCCTGCTTCGCTTAAATTGTCGAATAAAATAGACTCTTCGCAAGCGAGGTCTTGGACCTACCAACTCTTTTTTATACGGGTATAAGCAACCACAACCACGATCTTTTGTTCGTGATGGTTCGCAAAAAAAAAAAAAAAAAAAAAACCTGACAAACCGACGGACCGACAGACAGTACACAAAGTTGCACTACTTACAACAGACCAGTCTAGACTAGCGCAAACAGAGACCGGACAGAAACATCGGTGTGCTATACGCTTTTCCAGGGATTTTGATGGTTCGAGTGGTACATGGCATCGAAACCATAAAAGACTTTCAACCAACGGGGTTGGTTCCGGGGGAATGGATCGAAGACAGGTAACCAACACACACACACACACAAAAAAAAAAAAAAAAAAAAAAGGAAAGAAAGAAGACGAGCCAGTAGCGGGGTTAATTGCGTACCTGATACTTTTTTCTTCTCTCCTTTTTTTCTCTTCTTTTCTTTTTCGTTCCTAATTATCCTGCGAAGCCAACGCACCAAAATAGAAACACAGGCGAGATCAGCAACCGGTCTTTGTTTTCCACGCTTACCACTGCCACATGTCCTCCCTCTCGTGATATCTGCGGCTCGCGATTCCGGGCTTGTAGGTTATGGAAAGTGAAATAGTGATACCGGTTTTTGTCTTTGTTACTGTTGTTTAGTTGTTTCCCGCCTCCGATTTCGGTCGATCTTTTGGCTCCCGTGTCATGCGCAAGCCACAGAAACGCCCGTTTAGTTGCTACAGATGGCTTACATCTGCCTTTTCTAGGAAGTAAAAGAATACTCCGTATACTCCGTACTCCGTACTGAGTAAACGCCGCTCAAGACAATTCCTAGGCCATATGATGGGATGCAGTATTACGTCATTTGCAAGTTTTGCTTTTTCCAGGATTTGATCCATGTTTTCTCCTCAACGTGTTGAGGTTTCTAATAAACTCAACGTCAACAACAGGGCTTGTATCTACGTTAGCAAGATGGCAGGCCTCTTTTCGTACCGGTAAATCTACATTTGAAAGGATTTGGGCGGCCTTTCTTCCTATAGGGCAAACTAGCAACTTGACGGTGAAAATAGATCGCCCTGGTCTAAGGTCGCCCAAAAGCCGAGTGTGAGTGGGGTTCATCGTCACCCACTTACAGCCAAGGGCCGGGGGCGGGGCCACACCGAAGTTCCATCGTACCGGGTTCACATAATTCTAGCGGCTTGGCGCCGAGCTTGAAGAGGTTCATCGTCGACTGATGTTGCAGAGAAAAAAAAAAAGAAGAAAAAAAAAAAAACACCAGTCTGTTTGTTGAAATGAATATGTTCAATTGGTAATCATAGCATGCTCTCCCTTCGCCGAAACGGTTAGCTCTAAAAGATACCGGTCCTCACTTGAGAAAAGAACAACCCCCAAAAGCCCTAGAACAGATAATCCTGGTGAGACAGTTTGGGCTTTTGTCAATCAAAAATCGTATTGTTTCTCATGTGCCAAGTCTGGGAGGTGAGCTGACGAGAAATCATGAGCATCAGCTTGTGACAGACATCGATTTGTAGCGAGTATCAAATGAATGTTGGCCGGCCAAGGTTCTTTATAAATGGGTGTAAATCGTTGGGCTGTGTTTATAAGAGATTATACCGTAACGCCTGCCATCCCAATTATCCTCCTTGTAACCCCATGTCTGCGTATGATGATGGTGTATCCTGCTGCTGTCGTAATTGCCAGCCCAGGTGCGAAACAAAAGCTGTGTCTTTGAGGTATCATTTTCTTTCTAGTTCATAAACTGTTCGTGGTATCATCATCATCGACTTGTGAAATCGGGTTGGCCAAAAGGCCTCGGTTTTATCCTTTGGTTTGGTGTGCAAAAATAGGCCCAGGTGGCCGGGCGCCTCCCGAAATATACTCCAGTACAACTTCGGTGAAGTGGTGAGTGTTTTCCGATATGGGCTGACCAATTGTTTTGCACTCGTTAGTGGACTTGGGCCGGATACCAACATTCATCTGGCGGAAGCAGACTCTGAAATGAGGCAGGCATAGGTTGCATGCAATGCCAAAAGGAGCCCCAAGAATACACGTGAAAAAATCAAACCACATACCTGATGACCAAGACCAGGTCCTGGAATGGCCTGATCTTCGAGCCCAGTACCACGTAGGTAGGCCCTGACGGGCTCCCTTTGCCGATGCTGCTCGCGCTGCTCCCTTCCAAGCTCCTCCGTAGCAACCTCAGTGACGAAGTAAGGATCGGCTAGAGAAGCCCCCGAATGCTGCTGCATGACGAAGCAGCGCTCCGCAAAAACTCCGTGCTCGTTCTTGCTCTTCCACGCCGGACTGAGGCGTCGTACCATGACGGGCTTCCAGCCCCCAATGTTCAGCGTGACTTGACGCCAGACGTTCTGGCTGGTATGCGAATACATGGCAACTGCAGCTGCAGACTTATGCCTCAAGAGTGCTGTAAAGATGTGCATGGCGGCTTCGGCGTCTCTATCGACCCCGGATATGACTTCGTCCCAAGGGTGCACAACCGTTCTAAGCCGCAAAAGAAGCTGTCAGACACATGTAGAAATAGCAAGTCGTAGGATGCACTCGGTGCCAGCGATGCGAAGAAGATAGAAAGAAAATGCATGCTAGAATAATGTTCAAGGGCTCTACTTACTGAACATGCAATGTCAGCGTGTGGAGACTTGGGAAGCGAGCCAGCGTCTCAATGAAGGCCGGAGGATTCGTCATTAAAGTATCCATATCCAGCTCTAAAGTGTGCAGATTTTTGAGCTCCCTCGCCAGCATACTCAAATGATCTAGCCACATGGTCGGGCATCTTCGGCTCTCGTCACCAAAGCCAATGAAGTCCCGCAGAGATAAAATTTCCAGAGTTGCCGCGTGCACCAGCAGCGAGGCTGGGTCAAAGTGCCGCATGTCCACAGTCAACTCGAGCTTTTTCAGTGACCGAGTTCTCTGGCGAATGATCCAGGCCAGGTGCGCCGACAGCTCTTCTCGCGTGTCTGATATTCCAGAGTCACGGGTAACTAAAGTGTGTAGTCCGTAGAGGTTGAAAGCTTCAATGGCACGGAGAGCCTTGAACACAGGCATGTCCAAGAGCTCTAGGGATTGGATACGTGAAAAATCCCAATGCCGAAGCACCTCCTCGCGGGAGTGACACCAGTCGTAACACTCGAGTCTCAGCTTCTTAAGTGGCGGCAATCGTTCTCCAGCTGAGAATGTGAACCTGGTCCCTTGCCCCTTATCTTGGTAGTGAAAAGATTCTAGCGACCTGGAATTAAGCAGCACCTGCTTCAGCCCATTGATGCCAGTCATGAGCGGTGGACTTGGGATAGCCATCTTTAAGGATACCAATAGTTCGGTTGGAATCGCCTCCAGATACAGATTGTGGTGATTCTCTAGGTGCCGGGACGCAACATTTTCGAAAAAGACACGCGTTCCTCGACGTAGCCTGCCATGACTTCCGGGAGTGGTGAGGAATAGCTGAGCAATAGGGCAGGTGCAAGCTGAGCTGGAGCGTGTTCGCGCATATCGCCATCTGATTGATCAACCAACCCAAATTAGACACTTAACAAGCAATGAGCCGTGTTGTTGACAAAAAGTCCTGGTCTTTGCCAAATAGTATAGCTAGGACGGACATACGTGAATGTTAACAAGTTTTGAATGCTGGTCGTGATCCGGGCAACAGCACGATGATTATCATGGCAGCTCTCGATCTCGTCAATAGACGCAAATACATGATTGGTGTGCAGACTTATGTTTGCGTACGCGTCATAAATGCGCTCGGGATTTCGGAAGTAGAGAAGCCGTTTTGTCAGGACAAGGGTCTGATATTCGACGGGCGTGGCCACCTTGTCGAACCAGCGGCAGACCAGTCTCACAGATATTATATCCCTGATACTTGACTCTCGTACCTGTTGCAAAGATGAACGAATAGCAGCCCAACCTGTTAGCATCTATGGAGAGACCAGTGTAGCCTTGAGAGATGTATATCAAAAAGGGAGAGAGAAATGCAAGACCGAAATGTGGGAATACTCCGCAGGCCAGCGGCAGGCCGAGTAGTGGCAGTAATAGCTCCATATTCCACTCACATGCTCAAAAATCAAGACCAAAATCTCAGACGCAAGATTTGGAAGGCGTGTACACGTTCTCCGTTGCCTTGACCTGCGTGCGGCAGCTGCCATGACTTGTGAGTCGTGGGTCGTCTTTGCCCTTTTCGATGGCCGTGTTGCTGGAGGCGGCGAAGTCTGCCGGCTTAAGAGTTTGGATAGGAGCCGGTCGCTGTGGTCTGAATGGAGGGAAAACGGGGTCCGACGGCAGACATTGAGGCTGTCCGAAGGAATTGTGTGTGCCTTTTGGGCAGGATGGACAGTGGCCGCCATTCCATGGGCTGTAGGATGAGCGCAAGGGATGAAAAATATAATACCTTACGTAGCTCCAATCAAGATGCCGAGAGTGGGCTGCGGGTGAGATGTCACCTTGTTGATGCTTCCCCTCCTGAGCTATGTAACCTGAGGAATTCTCTGGGCGAAGCGAGAGGGATGGAGGAGTGGAGGACGCCTTTGAAGGTTGCGAGGATCGCGGCGGACAAGAGGTCAATCGCAGAAGCCAAGAAATAGTAATATGGACGAATAGAAAAAGGATATGAAGTGGATGGGAATCAGACATCCAAACAGCTACAGGCAAGTTCCTAGGAACAGGGTGGCTGCATGGCTTGTGAGCTTGCCCTATCTGGGTGCGAAGAGCGATACTAATGCACCCAGGTCGGCAAGGTAGTAGTAAACTGAGGGTAGGTACGGAGTAGTTGGTTACTAGGTAGGTACCAGCAATAGTAGTAGTGGTATCCACACCCTCAGAATACGCACGGGAGTCGACAAGGGGTGCGGCTGCGGAGTGGATGCAGGCGAGGATATCAGACCGTGCGTGTGTTGGCAGATTAGGCAGTGTCTGGCCAGCCAGCTTGCCAAGAAAGAAGGTCTTGTAACTTGGGACGAGGTTGTTATTGCTGAGGGGTGAAGCATGTGGAGTATTGGCAGGTCATTAATGGGGTACGCAGTAAGGTACCTACCTAGTTAATGTGGTAACGAATCGGGACTGCACGGTAATTATCATAACCAGAGTTTCCCATCCGGCGCAGGGTCGTCTTCCATGTAGCAAGGGAGTGGTCGCACGCCACAAATGGAAAAAAAAGGAAATACAAAGAAGAACAAGGGGTTGAATAGTGGAGGCGAACGCAAGCGTTCGGGAGCTAAGTTGACTTGAGTGCTTCATGGCGAGAACCAAAAGTATAATAAGCGCTGACGGGTCATTCCACCAGGATACATCCATGGACAAGACATGGACGGGGGATGCTCTAGCGCATCAACCATGGCAAATGGTTCCTCAGACGCGGCGCTGGAAGAGAACAAGGTGCCTTGCCTTGCCTTGCCTTGCTTGTGACAGTGGAGAAGTACGTGGGAAAAAAAGAGACGATATCAAGCTCAAGAATAAGGTTAGACTTGCTTGTGAACATTGGTGCTATGCTAGGTACAGGTAAAGGTAAGTAAGGTACCTGAAGGTACGTCGGAACTTGGCACCAGTACTCGGTACCCTACTAGATGTAGATGTTGTGACGGCATTGGACGGGGAGAATTAAGGATGGGACGAATGTAAAACCGTGACACTTAGAGCTGTGTACTGTGGGCCAGGATGATGGAAAGACAAGCGCAAGTCAAGTGCCAAATTTGGGTCTGGTCGCGCCTGCATTTCGCGTCTGTTCTGCGTTTTGGGTTGCCGGCCCCGAAAATGGAAGGAAGCAATATCTGTCTTGGTCTCAGAAATGAGAAAATGACCCGATTCGACCAACAGACCGCCAGCTACCTACACCCACGGACTGGTTCCAGTCTTCTACTGCTTTACCCGGAAAAAGGATGTACACAGTAGGGCTACAAGCAGCCAGGGCAGGGCAAAGCAAGGGATGTGAAGTGAAGTGGAGATTTTGATCGTTGATTGATGAAGGTTCCAAGCCTGCTGCTGATACTACATACCTGGGGACAATATTCTTTACTCTTCTTGACGGGTTATTTTTTCTTAGTTCGCTGCAATACGTTGTTTTCGGCAGCTTAGGTTGCATATTTGTCAGTTTTGCGGAAAGTATACCAAGTACCTTGGCTACCTCAAGAAATCTCGATGCAAACTTGGGTACCGGTGTTGTGTTAGGGGGCAGCCAGTCTCTGCCGTCCAGTCTCCAGCCGGAGGTACGGTACAGAAAGAAGAAAAAAAAATATCTCAAAGTTCGCAAGTTTCGCCCAAAAAGGCAAGTTGGGAGAGCCCGTTAGATCGCCGTATCCCAAGGTCGTGGAGACCCTGCCCGCAGCTGCAGCTTCGAAAGTGGGGTGGATGTGGGGTGGAAGGAATCCACTCGAGGTTCTTTCGTATATTTTTATTTCGACTGCTTCTCCTTTCCCTTTCCCTTCCCGCTTCATACAGAAGACGAGAGGAGAGCTTCACCTTTGTCTGAAATGAATCATTTACCCGGTAAATATCAAACATCCACCCGGGCTTGACAAGCCCCGATTTATGGTTGCACAGATCGGCAGTTGTTTCCCTAGAGAACTTGTTAGCAGCGTTGGGGAAAAAAATCAACGTCCTGTGGATTCACACTATTGATGAGACAAGGTTTCGAATATTTATTCAATGCTACTCTCCTGGTGAGCCGCAGCGTTGGAGCTGACGTTGTACTTTGCGCTATGGGGTTGGCTTGGATGGCGTCGATCCGGAAACGGGTCCGCTTTTCGAAGAAATCGTGACACCAATCTGCCGCAGCACCGCCAAAACCTAACAGCTTGCAGAGCTCTTTAGTATTAATCGCCAGGTCACCGCTATAGATCAGCTAATGCTATAAAGACTGTACCTTGCAGTCTTTATCGAGACTGCTGTTTGTACTCATCGGAGATTCACTATCTTTTTTGTTCGTTGTTCTACACAGGTTTTTGTCATCTTTTCTGGTCTCCTTTGGTAGAGTTCCTCTGAACTTGACCATGTGCGCGCGGGCCGCTAGGTAATGTGGGCCTACTAGAACTACCACGCTCTAGTTGAGCTACTATTAGATTCCCTGGGCTGTCCAATCGCATTCCTCGCAGCAGAGGGGCCCTCCCGACATCGTCGGGAGCTGCAAGCGTGCAGCAGGCACCTGTGTGGGTGAGGTAAATAGCGGCTTGGCGCCCCAATGTTCGTCTTGGAAATCCCATTTCTCCAACCTCTTTATCCGGCAGAACACCTAAATTACCAATCGCACCACCATGGTAATGCCGCGAATCACTTCCGAATATTCAACATTTAATTCTAGTTGCCACAGAAAGAAAGAAAAATGTATGTATTTATGTAAGTATATGCACATTATCTGTTGAGCGTCGTCATGGATATTCCAGGGCTCTATCCTCATATCGGCATAAATCTTGGCAGTCTGTTACTGTCTTCTCGGCGTCTTTAATCCAGAGTAAGCGTACCAAAACAACGCTTGACTCGATTATGACTTGATTGTACTTCGTAGTACAGGAAATCACCCGGACGAGATCCACACCGTTTTACAGCTCCCCTCTTAGCTGCCAGTCGCAACCACATCATCCCGCCACGTATGACTCCTGTTCGATACCGCCTTGGCATTCGAAGTTTACGGTACCATGGTTTATCATCGATGATTGAACTTGTCTTATGGGTGTCAGTGTGTCACTGTTTCTGCGGCGTCAATGTCCCCCACCTTTGGCTAGCGCGGGTTCGCGTGCGTTTGATGGGCTTTCTGGAACCAATCGCAAAGATAATACAAGGCAGAAAGTTAGTTTTTTTGAGAGGAATATTTGTTGGTAAATTGGGTACAGTATGGGAAAACAGAGCTGACCTAGAGCCAAGGTATGCGGCCAGGGATAAGAAACTCACTCACACTGGACCCAGCAATGGACGAAGGGAAGCAAGGCGACTGGTCCGATCTCTGTGTTATAGTATCCATTCATTCCAACTATTCCGAACTCCGTACCTAGGTGCTCCGTAGTTGTCTTCCTTGCCTTACCTGCATGTGCATGCAACCCTAGCATGCCCGCTTGCCGCCTAAAACCAGCATCCCAGAAATGCGAGTGGCTTAATACCTGCCAATAAGCAGATTCATTCGTACATTGTTATAATAAATCTTCCTTTTTGCCACGAGGTCCAAGCTCCAATTGCTCCCTTGCAACGTTGCTACCTACTCAGCTAGGCTTTCTAGGTTGTCAGTAAGATCGGTGATTTCCATGGGTGGCATCAAAACAACAAACAAAATGGACCCCTGCTTGTGCTTACTTTTTTTTCACAATCTGACTAGCAAGCTTGCGAGGCTTGGCAGCAATCGTACCGGTAGTATTGATAGAGGTAGACCAAGAAAGGCAATATTAGCCCTCAAAGCTCGCAAACAACACACCGTTTTTTTTTTTTTTTTTTTTTTTTTTTTACCAAGACGTTTGAGCATATTCAATAGTAGAACAGTCGGGCGGCGTATCCGTCTCCCCGGCCCCTGGCACTTCCATTTCTTCCTTTCCTATATCGGAATACGCAAGGATC
TGTTGATAGGCGGGGAAGGGGGGCTGTTTGAACGGGTCGTAGCTAGTGAAGTGCCTTCCCTCCTTATTGACCACCGGCGATTTGGTTGCTGAGGCTTCGG
CGGCCCATCGGATATCGCAAACTCCGAGCTGGTGCAGGCCGCTTCCGGCTGCTCGATGTTGGGCCTTTCGATTTGGGAGTTGGATCGTCGGAAAGCCTGG
CTCATGCGCCGGAGGGGGTTGCGGGAGTTTTTTCTCGAGTGAGTCGGCGGGGTGGCTGAGGGTAATGGCTGATCGGCGTTTGCGGCGGCGTTTGCTGTGT
TTATTGGGACTGGGATACTTTTGGTTGCCGATGTGCTCGCCTCAGTGTCGCTGGGTGCAGTTGGAGATCTGACGGTTTTCGTCGAAGTCGGCGAGTGTTC
TGACGGTGCCGGTTCGGGGCGGTCTGGAGTTGCAGATGTGCCGAGAATCAAAGGGGTCTTGTTTGTTGGGGCGGCGTCGTTTTGAAGTGAGGAAAAGGCA
CCAGTCGAGTGTTCGGCAGAGGAGGAGAGCGACGTGGGATGTGTGTCGTGGTTTTGTAAGCTGTGGAAATCTTGGGACTGACGGCCGCTGACTGGAGTAA
CAGGCTCGTTTGGCGTATCGCTCTCAGACGACTCGTCTTCCTCTTCAAGGATAGAGCTAGTAAGCCCGGTCGGAAATTGGCGTGGCGATGAAGAAAGGCT
GTTTTCGCCTTGGGCAGGATCTGATGCTGTAGGGCGAATTGGGGATATAGTGCTGATGCACTTTGAAGGGTGTGATTGGGGTTGCGGTTGTGGCTGTTTT
TGTGTTTGCTGCTGTGAAACGCAGGCGTCTTGGGGTGGTGCACCGGATTGCAATTGTTGCTGCTGCTCTAATTGCGGCAGCTGTTGTGCGTTGTTGCTGC
TGTTATGAATAGGTTGGGGGGCCGTTGCAAATGTCTGGGACGCTGCACGTAAGGGTGCAGAAGCACCACCAGCTGGTTGTAAAGTTGCCAAGCCGTCCAT
GGCTGTCAAATAAAGTGAAAGGGCCGAAGTGGGAGGAGTTTAGGCTTCGCAGCTTGGGATCGATGCTTTGCTTTCCTTTCTCTGCTGTAGAAATCAATGA
GGGGTGCGTGCCCTTCTGGTCCGGTCCTTGCTTCTAGGTAGGTACTTGTTCCGGAGGACCGACCTCGTGCCAGTGTAAATACGTACACTACGTCAGGGGG
CCTGGGGCGCTTGCAAGGTGGTGTATGGTGTAGTGTGTCTGGTCGGGCTATCGGCCGGTCGGGCGGGCAGGCCCTGGGATGGAATGGTGGATTTTACTCA
ACTGGGTCACCAAGAGAGGAAATCCCAGCCACCAATCCCAGGCAACCAAGCAACAGTAGGGAAAAAAAAAGGGTCGCCGAGAAATGCTGACCGAGTTCGT
GATTTATGAATCGGAGAAAGCGAATCCAAAAAAAAATCCCACCATATGCTAGCACGCAATGACCGGGAAAAGGTGATCCCCCTCCTTTTTGTGTTTTGCC
TTTTATAATCGTAAACTGACAACCGTATCTCCGGATTGTCTGTCGGAAACCTGATTCAACTTCTTTCTATGCTGATGCACGTGTGGTGGCAATGTCTTTC
GCTTGTCGAAGTAATCGAATCTCCAAAGCAAGTTGTTGTAATCATGCCGTCTTCTTGGCCCTTTGAATCTTCTTTCTCGCTCCTTTTTTTCTCCCCTTGT
GCTTTTGCGTAGAAAGTCAGGTGCCAAGACTTTTCTCGAGGATGGTGGCTGCAGGTGTCGTGTGCGCCTTGTGCGCCCACCGTCTTGTCAAGTCACGGGC
AAGGAGGGCAGATAGGGTATATTATGCGTCGATCGGGATCGGGTATGGATCACCTTGGTTCGTCTATAGATTGGATAGGTTTTCCACTGAGTTAAGTTGG
GAGGACTAAAAAGGGAAGTAGAAAGAACAAAAAAGTGATAAATTGATATGGACAAACGAAGCCAAGCTGCTTCTTGTAGAAAGTAAAAGCCGACTGCGGT
CCAGGTCGTTCTAAAGGTGGTCGCGGATGCCCCTTTAAGGAGGGGAGCAAAAACAAAGTCGGTCTCGTTTTTACTGCGCTGCCGTGGGGTGGCCCGGAGC
TGTGCTTGCTGGTGCGGAAATAGCTCAAATGCGGATGCGGGAGGAGGCGTAGCAGCAAGACATACAAGGCAAGGTTGCAAGGTTGCAGGGTGTGTCGCAC
CGAATCGTGGTGCCTGCTGGGTCCTAGTTCTTGGTTTCTGGGGTCTTGGTTGCTGGAATAAAAAAAATAATAAAAATAAAAAAAGTCGGCACCGGTCTTC
TCCCCAGTCTAAGCTGGTGTCCCAGAGAAGTGCCTTTTCGCCAAGGCACTATCTATATGATAGGTTGACTTGAATAATGCCAATTGTAACGCCAATTGGG
GAGATAGCTAGTTCCAGACAGAGCTCGTGGGAAAAAAAGAACAAGTCTGCAACCTTAGGCCGGATCCATCGGGGCCGTCGACGACTATCGTGGCGTATGT
TGTGGTTCTCTTCCTGATGACATGCCAAAACCAGACTTGACAGTGTTGGTGTCGCTTCGAGGGATTTTTGTGGATACCTTGGCCCAGGATCTGCAGTCGA
GGGCTCGAGGTATCTTGAACCTGACGTTGGATTGGCTGATGGCAAGGTTACCGGGAATAACTTTGAATACTTGAAGGCGAAGAATGATCGAATAGGTGGT
AGAAAAAAAATAGTATTAATAAAATAGGCAATGAATGCCACGTGATAGGCTGAACGAGGAACGACCGCTCAAGAACCTTCACGGGGAAGAAGACGAAGGA
TTAAGAACTTGTCAAAAGGCAAAACTGTGTCCCCTTTCTTCGTATGCTTCTTCTTAACACTCGATAGATATTAAATGCATCAAAATGGGGGAAGTCAGTG
TTTTAAAAACACGCAACACAAACAAGTCTGTCCCCGAAAAAAGCCGCGTCCAGTTTCGAAAAGAGCAAGTGGAGGACGAGGGTATGTATCGATATGCGTG
CAATGTGTAGCGTAGCAGCACGGCTAGGAAGAAAAGTGGGCAGGAGAATATTACATGGAGAACGAAGTACGGGGGTGTGGTCTCGTAACTCGTAACAATT
ACTCCCAGTCCGAGAGCCCACCGTCAGTATGCTATGCTGAATTTGTACGTCTGGCTGTCATAACATACTCATACGCTGTTGACAAGCGTTACTCGATTGG
CTAATTTTCATGAGACCAAAATGCGAAAGAGTCGGGACGTCCAAGCGAATCAAATACGAGAGGAAAGGGAGAAGAGAGATCACGAAAGGAAGAGAGGAAA
AAATAATAATATCAATAATAATAATGATAATAAAAATATCGGCGGCATTCCATTCCCCTATGCAGAATCCCCCCGCGTCAATTAGTACATCACACCGTCG
GAAAACCCATCCGCGCTTGTGGGTTTTGCAGATAGGTCCGTCGTCGGCCACATCATATGTAAGGCGGGAGCAAGCACGTACCCAGTACTACCTTGCCTTG
GGTCCCGCGCGCCGAGACGCAGGTTGCTAGCACTTTTTTCCCTCTCTCTTTTTTTTTCCTTCCTTTTTTTTCCAATGCGAATTGGCAACTGGGGAGCCCA
TCCCAATGCCGGCGGTACAACGTCAATTTACAATTATTTGTTAGTCGTTCAGTAATATTACGTTGATTCAGGAACTCCATATAAAGTAGTATAGGCTGGG
CAAGCCCAGTGGAGAAGTTCCTTAAATCCTATGACGGTGAGGGGAGGGTGCGACCGCACCGGCAATAGAGCCTCACTTGGCCTTTTGTTTCTACTATTCA
TTCAACAAAAAGTTTATGCCTGCTCAAGGCGGACAATACCGGTACACCATTGTTTTCATTAATGATGATCATCTTTACAAAGTGCACTGTCTTGTCAATT
CACACCGAAGCCTAAAAAGCCTCTCGGCGCGGTAACTTCTTGGCAAATGCAAACAAACTTCTACCGATATTTTTGTCATAGCGAGCAGGGCTGTCCGGCT
TGGCTTGACTTGGCTGGGCGTTGTCCATCGAGCTTCCTCTTTCAATGAATGTTGAGTTTGATGTTTCATTTCATGGTCAACATTGTCAAGGTATCCTTTT
TGTGCTTTTGGCTTCCAGGGTGTAGGTTGGGATCATCACCGTCTATCGTTGGCAACGGCTTCATTTCCAATATGACCTGCCGAGGCTGAAGCTGTAAATA
CAAGCTCATGCCGGGGTGAATGAGCCTTTTTTGAACCTTCTTCTTCTTTACATTACTCTCTTCTTCGAATGTCTGACAATTGTCATTTTTTCAGGCTTCC
GACTGGCTCGCCTAAAGATTTGTAGCCTGAAGAAAAGTCACAGTTGCGTGCTAGTCTAGTGCAGCAAGGTACTTGCTACGAGAGCAGCGCCAAGTCCTTG
ACGTGACCCCCGCGGAGGTATGTGCACTTTTGGGGTGGGTAGCGTTGCAGATGGGGTTTGGTGGGGTATCCTGCCCTTCCAAGCCAACTAACGTTTGGTT
TGATTCCGCTGTTGCTCCACCGTATTTTTGGTCAGCAGCCACCAACGTGGGAGAACATTTGTACCGGATCTATGGTTCACCTGGGTGAAGTTACAGTTTT
GGAATGCACAACAATGCTGTAGACAGTGGCGACGGACAAGACTTGGATATGTAACTAGTCAGCAGGCAAGACAAGATCTGTCTTGGCCGACTTGCTGCTT
TGGGATGACGAGATGTCAGTGAAGCCAGTGACCCGGCCAAAAGGCCGACGCGGAAATCAATGGAAGGGTGGATGGTCATGACGGCGCCATGATTGGTTTG
TTTCCTCTACCACACCTCTCTTTTTATCCTTCTGGACAATTTCGATTGCGCCCGGAGCTGCAGCGCATCAGAACCAACCAGGTACGGCCCCGATCGATGT
GTCAAATCAAGGACAAAAGGTTCAATCAGTCAACCAGTAGTTCGGTATCGGTTCCACTCATGGATGTGATTTATCACCAGACTGTCGACTTGTTGTTCTA
AATCCTCAAGTCGTGCCTCATTTGAGGATACATCTAGACTTCCCAGATAGTAATAAACATCAGAGCAATTCATTCGGCTTCGCTGAAGCACGCCAAGACG
GTCGTTCACCCTTATTAGGTGCGCGATGGTAAAAAGTCTGCTTGTCCGGTGCCTACTTCGTATTTTTCTCTGGCAATTCTGCGTTAAGGCATGCGCCAAA
AATGCCACCAAGGTGCGACGGTAGCATCCAATGATTGTACATTTAGGGGGGGTGGGGGGGGGTCACATTTTCTAATGCCTTCTGTCATGCTCTCGTCGGC
CTGAGACGCACGTCTGCCCGCTCACCTACCTTTGGTGGCTCATTTGCCGAGTGCCGAGCGCGATAAGGTAAATGAGCATTATGTGAGCAGAGCAATAAAA
ATGGATTCATGTTAGCAGGACACGCACGACCGGACAAAATGTGGCTATCACGTAAAGAGTTAGTAGCTGGGTAAGCATCTCGGCCACTGTACCTAGGTAC
GCAATCTTGGGACCCCATCGCTTCGCTTCCATGATGGGTCAAGTGATATGGGTCTCGACGGAGAAGGGTCCTCTAAAATTGCATCATAGGATCAGGGATC
TATGCTTGTTCCGCGTTTCTGTCGTCTCGATTTGCCTACGGTTACCAGCATCCATCGATGAGAAGACGGCGGCAAAATAAATAAGGACGACATGATTTTG
TGGTAGATATGGGTATCCATGGATGACGAAGCATCAGGATTGACCGCCAGTTGGCATTAAACATAATTGACCAGGTGCTACTGTTTTAGTTGTATTCATT
ATGATGTACGTTTTTCCAAGGCATTAACAAATAACAGCCTCAGGTTTACTTAGCAAAAAAGCTCGTACACCCGGAATGTGGGACATTTGTCGCTACTCGG
TGTTGAGGGTCTCACTATGTAGAAGGTAGGGGATGAATGGTCTCAAGTTTCCCCATGACGCCATCCCCAGTTTGCGGGGCCCCCATTCCAGCTTTCTATC
TCCGGCTTCTTGCTTCCTCCCAACAAACAAACAAAAAATGAGAGCCATGGTTTACCTCGGAGCGCCACTGCCCGAATGTACGGCCTACAGTTCAAACCCC
GTGTCGAGGTCGTCAGAGAATGGAAGAAGATTGTGTATTGCAGGGTCGTGACCCCCCCTTATTGTCCCGGGTTTTCCTAATCTAACAAGCACTTCAGAGT
CTCTGACTTGTGTCAATAATATGGATTGATAGTGGCGGAATGGGATGCCCGAACAAGTCAGGGTAATTCCATGTAAGCTCCTAATGCAAATGTGCATTTA
CGAAAAAGCAACAAGTGAGCATCTGAGGCGAGCGAGAGAAAAAAACAACAGGTTGAGTGTTACCCCCACCTTGACTTGCATTCAATAGGCGCTATTGCGC
AACAGGATCAGGGTCTATCCCTGATGGATACCAGCAAAAGACGATGACAGCGGAAATTTGACCACTTTTTCTTTTAGCCATGCGGGTCCGAATCGCCCTA
TCATCAAAGGAGACACGATATCGAATCGTTCCCGATTAAGACCCGTGCAACCCCGTTGCAGCCTTCTCACGATTGATGTCTACTCCGTACAGTATCTCCT
GCATTTCTTTCTGAATGACTCGTAAATCCCCAGCCTTGGCCGACCTCTCTGAAGGAGACTATGCCCGTCTTACTCCCTCCCCCTTATTGTCTCCTTGACC
GCTCATTACTGCACAAAGGGCCACAGAAAATTTCCGGGCTCATCTCGGCCGATCTTGGGGGCTCTGTTCTGTTTAGCCGCCCGCAACGGGCCTCCAAGGA
TCTTTTTGGGGTGTGTGTGACAGACAATAGGGCATGTACTAACGCCCGTATCCGACCGAAGGTTCATCTGAGCCCGGCAGTTCTGGGTAAACTTTAACAC
TGCCAAGAATAGAGAAGTAAACTGTAAACAAGACAACAACAAAAAAAAAGTTGCCGATCTTTTTTCTTTCGTTGTTGCAGAACTGCGGGAGCTAGCTACG
GGAGCAGAGTTTCTAAAGTGTTTCTAAGACTTCTAACAAATTGGGTTTTTGTGGCTTTGGAAAGAGAGTTCAGCCACTGGTTCTTGGCGGGACTCAGAAC
ATAATTCCCGGTGGTAAACCAGCAGACCAGTAGTCATTTACCTTTTCTTCTTGATCAGATCACGCTACACCACTTGCATGCGAACGCCCATTTTTCTCTT
GGCACTACGCAGGGCACACACATACGCATCAAACTGCCGGAGGCTGTGAAGCAGATCTTGTCTTTATTATGGAGCTAATATGGTGCTAGTCTGTTGTCTT
TGTATCCTCAAAATTGAGATGGATAAATGGTAATTATACAGCCACTCCGAAAGAAAAAATAAAGGAACACAATATGCCAAGACGCTGTGGGTTGTCAATG
CCCGTCGAGCCGGCTTTCTTGGCATACATAAGGTATGGCATAGCCTCCCCGAGCGGCTCAAGAGCCGGCGATGTCAAGGTGTGAACCACATTCTGGCTTT
CTTGGCACTCGGTGGTGTTATGCTTGTTTTTCATGCCTCATTTTTTTGTATCTTAGTTTCTCGAGACACAGCACAAAGGAGGTGCCGGCACAAATAGGCG
GTACCTTACCTCCGATCGAAATCAGATTACCAGTACCCTGAACCACCCACCTGCTTGGTTTTTCTTCCTTGTCTAGATCGGTTATCTGCCAGTTCATCTC
AACTTTTTTACTTTGACACGTTGTGTCGACTTTGTCGCTTCAATCGTAACCCGTCCCGTCGCATGGATCAAGAATACAAAAATAGTCACTGCATGACTGG
TCACGAACAAGATAGATCAGTCAGCCAACACCAATTGATCCGATGGTTGGAGGATCACCCACGTTGACGTCCTAAAGGGATTTATTCTGGTTGGTTGTCA
TTGTCGGGACGTAGGACACTAATTGGCTGCACCTTTCGTTTATCGAGTAGAGCCAAATTCATGTCCAACCGAGATTGCACTGGCACTCTCTACTTTAGTT
GTCTGACACGAAGAGACCTGTGCAGTCCCAAAACTGGCAGCAAACTTTACAGAGATACCCAAGCATGCAAGGCTGGGAGATCCTCCGAGTTTTGATGCTG
GTTTGAGCCCTGCAACCAAATCATTCCCTCGATTACTTTTACTATGTATCAACTGCCTATTCTTATCTTTCAGAGTGCCATGCGAAGGCTCAGCGTACTG
GGACAGGCGTTCCGCTATGTCTTGTTATAAAAAGAGTAAACAATCATGGCATAGCTAAACCTCGAATGGCGATCATATTACGATCCTATATACGCTGACA
ATACCTATCCTGGTATGTAACGCGCACACTCACCTCATGTCTAAGTAGTACGAGTCTTACAACTTGAGGCGTGATGTCTGTTGCATGGTTTCATTCGCAG
CCATCGCACTGATATTGTTCAGACGATTGTGTGGGGTTGAGAAAGATGAGCCTAAAGTCGAGCGGCTCTTGGACCAATTGCATTCTCGCCGACTGCAGCT
GCGGTGCTGTAAGACCACATATGCACAACTCATGGAGAACATGAAAAGGGTTTCAGGGTCGGCCATCGATCTGGGAAAAACAAAGCATCGAGACCTGCTC
CTATGGCGACTGACGGCAGCAATAGCACTTGCTTGACTTGCGGCGGATTGAGAGGTGACAGGGTGACAGGGTGGCAGTGTGATGACCCCCCTGCTACCAA
ACAACCGTTCGGATTCGGAATCGACTACATTGTGTGTTTGTTCTCTGCGCGTAAGATGACTCGCCTTCTGGTAGTAGAAACTCAAATTCAACAATAATCA
GCATCATTCTATCCCAGACGACCAAAAGCAAGAGAGGCTGGCGGTATTCAGATCTCCGATCTTCCACAGGCACTAATGGGCTCTCCCATACCGTTGAAGC
CAGCTTTGGCTCTGGCAACACAAAAAAATTCCCCGAGTGGCAAAAAGGCGTTTCTTGCACCACATGGCAAGATTGTAGGCTGGCCGTCTCGGGATGCAGC
CTTGAACAAGCGAGTGTACACCGCGTCCTCCGCATGCATACTGGACGCAACATAGAGAAATTGACAATAAAGGATGCTCGTTTGGGAGATACACAGCAGC
AGGGTCTCCACGGTGGGTAGGAAGACTTGTCACGCTAAATGGCACTTGGCCACACGTGGGCATTTAGAGTCTGTAAGAAGCAGAGGTATAGCCAGTTTCT
CCTCATTCGCCTAACAGGTCAGGGCGTAGCAAACTCAAGTCAATTGAAAGGGGATGTGGCTTGTATGTAATGTTAATAGCTTGGTGGAATTAGTCTCGAG
TGTCTCCAGGTGCGGTGTCTTCGCATCGGTTTCTCCATGTCATCCTTACATTCGCTGAATCTCGCACAAGGGGTAGTAGCCACCTATCGACTTGTTGGGA
ATCAGGGTATCTCTTTCTTCACACAGCACTGCCAGTGATGATGCTGACCAGGGCCAGCTGGACACTGGGCAGAAAGGACTCAAGGCCGCCCACGGCGAGA
ACGCCAATGCACGGCGAGAGTGTGCCTTCCTAACCGGTCCCTACGGCACAGCTCAAGTCAGGAAGCGACGACTGCTGCACAAAAACGTTTGTTCTACGAG
AAACTCACTCGGGTTTCTTTCTGTGTCTTTTCCCTCCCCTTTTTCATTCCATCCTTTCTTCGACCTTTTCTCTCTCTATTTGATCCAATCGTAACCCAAG
GCTCTCGCCTCTCCTACCATTTGCAGACACCTACTCGGGCAACCACAACCAGCGGTCATACGCCTGCTGGTTGCCAGCCAGAGGCTTCTTGGACCGTATG
GTACTGGAGAGATCCCGCGTCAGCTCGCGATAGGCCCGCGCGTTCTGTCCCTCGGCACCCTCGCATACCGTAAAAGCCGCCAGCGCCCGGGCCGCAAACA
CAGAGGCCCGCACGTAGTCATCGTGCAAGAAGCAGCTGCTGCTGGCGTAATGCATTGCCAGGCCCAGCTCGTACGTCATTGTGGTCGGCGCGCCTCCGAA
CTCGAGCTGCTGGAGCGCCACGATCCTGCGACACAGCGGTAGGATCCGCGCCGGGGCAAAAGACGACGGTGGTGGCTGGATATCCCACTGTTGTCGCCCA
TATCTCTCTTCCTCCCCTTCCTCCTTGTCCTCGCCGTCCTCTGTGCTCTGATCCCTTGGGTCCGCCGTCCGGTACGCCAAATCCACTTCGGCCAATATGG
CGTTCAACTCCCGCCGACGCTCGTTGCTCCTTGCCACTTCGTCCGACGGTAGGCTGCAGCGAGGGCACGCACACCTGAACCCCATGGTGGTTTCCATCTC
AGCCGTGGTCTGGGCGGTGCCCCGCGAGTCGTAGGCGACGGTGAGCTCGTCGCCCGGGGACACGTCTGTGATGGCGTGGACTAGACAGGTACGCGTGACG
CGGTCCCACGAAAAGTGGCAGTTGGGGACGCACGAGTGGTTGAGGCGGGAGGCATTACGGAATACGGCGGGAACTGCTTTTCTGTGTGGGTTTTGATGGT
TTTCTTGCTGCTGCTGCTGCTGCTGCCACCGCCGCTGCCGCTGCCGCCGTCCCTGCCTGTCGTCGTCGTCATCTTCGTCGGTTCCGAGGGCGTTGGTGAG
GAACCTGGAGGACAGCGGGTTATTTTCGTCGGCGCCGTTGGTCGACAGGGACATAAAATCAGCGCGTTTGTCGGCTTCCAGACTCTGTAGTTTCTCCTCG
AGGTGCAGCTCGAGTTCGGCTGGCGGCAGCCTGAACCGGGCAAGGTCGACAGTGAGGATGGGGGCTTCAGCAATGATGCGATCGCCCTGCCGGACGCCGG
ACGCCGAGGCAAACAGACCCTTGCCTTTGCCAGGCGAATTTCGAAGCTCGTACATAATGCCCATGATCTGCGCTGTC
CTATGTTTTGTTTTGAGACGTGA
CACAGATCTCACCGCTTGGGCCTCCGACGAGGGCAGTGGGGGAAACAGGAGAATGGGTTCGCAAAAGAAGGTGAGTACATTTGCGAGGTTTGTGCTGGCT
ATCCAGTGGATAATGTTCAAGCAGTTGTAGGTTGCAGACTATAAGCAAAGCAATGCATAGTCATTTCTGGGCGACGGGAAGTGGACCGAACCAACCCAAG
GGAAAGAGATACATTGCACTTGTTTTAGTTGTGTTACCTTATACCTAC
CCAGGCTTTCGTCCACACACAAGCATTAGAAATGGGATTTTGACGGCGGTCC
GGCGCCGCCGAGTGGCCAT
TGTTTGGCTGTCTTTTGCCCATGCAGGGAGACCGGTGAGATTAGAGGATTCGATGGGCTTTTTGGGCAGTATGATTTTCAG
CTTTGCATGGGGGAATTACTCTCTCGAAAACCCATCCCCTTGTCACTGTATACGAATGGAGTGGACAAAAACCTGACCAGTCTCACCGAGAGCCAGGGGG
GGTGCAAGTAATCCCTTCTTGGACTGTGGTACCGGTACGCTGTGATACGAAGGTACGCCAAGTCTGCCTAGGTCCCCGGGCCGTTCAATTTTACGTACCC
TGTCAGGCCCTGTACGTATTTTTAGGGGGTGAATAAACAGGAGGGTTGTTAGGTTTGTAGCAAGGTTTCTTCTCACTTAAATCCTAGCAATATACAGAGC
GTACAGAGTACTACGTGGTATTTCATATTCACAGCGAAAAAAAAGTTCCGTTCGTTTCCAGGTTTCTGTTTGGTTGCAGTCCCAGGGGCGCTGCACGAGA
GTGTGGCAGGACCACGCCTCATCAACGTCACAATGTCGAGTCCATCCCGGATACCGGGATCACCGTATCACATAAATCCATTACCGATTTTTTATTTTGT
CTTGGCTGTTCGGCAAATGATTTTGTGGACAAAAAGCCGCCGACTCCAAAACTCATATATGGACCCTGGTTTTGCTTTTGATGTTTTTGAACTCTGGTCT
TATTCGCTCGTCATATTCTATAATCTGCATCGATAACGCCTTTTGGGCATCTTTGACTTTGACGTTGGGCTGAGACGTTGCCTATCTTCTTTAAAAAGTA
CTATTTATTGAAGTCAGGATATTCTTTATTATTCAATATCTCCCGGGTTTTCCTATCAGTCATCAAAATTTATACGCGTGGGAGCAGTTACTCCCAAGGT
ACGGAGTATACCTCTCCGCCTCTTTCGCCTTGTGTACACATCCAAACCTGCCAAATATGGGTGATCATGAGCTCGGAACAAATCTTGTTAGTCTGGCTTG
CTCGGTGGTTTTGTTTTTCTTAATTTACTCCGTACACGGCACAATGGACGCCTCCCGGCGCTTCTGCTCCGTAGCTTTTCTGCTTTCTTGTCCGTCGTTC
AATTCATTTTTCTTCTTTGAAAAATGAGAGCTATCCGGCTCACCTCCTCGAGGAGTCGCAGCTGATGGGAGAAAATTTTGTGTGTTTTATTTCTTCTCCA
ACTGCATCCAACGTCGCACAACATGAGAACAACAAAAAAAAACCAGATTAGTGAACAGGCGCCTGCCGGCATGTCTGTTTTTTTTCTCTGTGCCAGAACC
ACCAGATACAGGTTCCCACGTCCTTCCAACCAGCGTGTTTTTGCGCCGCTGATGTCTATTAAAGTCGAGGGATGAGTTCCTGTCTCAAAACATAGGCGGT
AAAGTGGACGAAAAAAAAAAAAAAAAAGCCAACCAATCCCTGCTTCGCTTAAATTGTCGAATAAAATAGACTCTTCGCAAGCGAGGTCTTGGACCTACCA
ACTCTTTTTTATACGGGTATAAGCAACCACAACCACGATCTTTTGTTCGTGATGGTTCGCAAAAAAAAAAAAAAAAAAAAAACCTGACAAACCGACGGAC
CGACAGACAGTACACAAAGTTGCACTACTTACAACAGACCAGTCTAGACTAGCGCAAACAGAGACCGGACAGAAACATCGGTGTGCTATACGCTTTTCCA
GGGATTTTGATGGTTCGAGTGGTACATGGCATCGAAACCATAAAAGACTTTCAACCAACGGGGTTGGTTCCGGGGGAATGGATCGAAGACAGGTAACCAA
CACACACACACACACAAAAAAAAAAAAAAAAAAAAAAGGAAAGAAAGAAGACGAGCCAGTAGCGGGGTTAATTGCGTACCTGATACTTTTTTCTTCTCTC
CTTTTTTTCTCTTCTTTTCTTTTTCGTTCCTAATTATCCTGCGAAGCCAACGCACCAAAATAGAAACACAGGCGAGATCAGCAACCGGTCTTTGTTTTCC
ACGCTTACCACTGCCACATGTCCTCCCTCTCGTGATATCTGCGGCTCGCGATTCCGGGCTTGTAGGTTATGGAAAGTGAAATAGTGATACCGGTTTTTGT
CTTTGTTACTGTTGTTTAGTTGTTTCCCGCCTCCGATTTCGGTCGATCTTTTGGCTCCCGTGTCATGCGCAAGCCACAGAAACGCCCGTTTAGTTGCTAC
AGATGGCTTACATCTGCCTTTTCTAGGAAGTAAAAGAATACTCCGTATACTCCGTACTCCGTACTGAGTAAACGCCGCTCAAGACAATTCCTAGGCCATA
TGATGGGATGCAGTATTACGTCATTTGCAAGTTTTGCTTTTTCCAGGATTTGATCCATGTTTTCTCCTCAACGTGTTGAGGTTTCTAATAAACTCAACGT
CAACAACAGGGCTTGTATCTACGTTAGCAAGATGGCAGGCCTCTTTTCGTACCGGTAAATCTACATTTGAAAGGATTTGGGCGGCCTTTCTTCCTATAGG
GCAAACTAGCAACTTGACGGTGAAAATAGATCGCCCTGGTCTAAGGTCGCCCAAAAGCCGAGTGTGAGTGGGGTTCATCGTCACCCACTTACAGCCAAGG
GCCGGGGGCGGGGCCACACCGAAGTTCCATCGTACCGGGTTCACATAATTCTAGCGGCTTGGCGCCGAGCTTGAAGAGGTTCATCGTCGACTGATGTTGC
AGAGAAAAAAAAAAAGAAGAAAAAAAAAAAAACACCAGTCTGTTTGTTGAAATGAATATGTTCAATTGGTAATCATAGCATGCTCTCCCTTCGCCGAAAC
GGTTAGCTCTAAAAGATACCGGTCCTCACTTGAGAAAAGAACAACCCCCAAAAGCCCTAGAACAGATAATCCTGGTGAGACAGTTTGGGCTTTTGTCAAT
CAAAAATCGTATTGTTTCTCATGTGCCAAGTCTGGGAGGTGAGCTGACGAGAAATCATGAGCATCAGCTTGTGACAGACATCGATTTGTAGCGAGTATCA
AATGAATGTTGGCCGGCCAAGGTTCTTTATAAATGGGTGTAAATCGTTGGGCTGTGTTTATAAGAGATTATACCGTAACGCCTGCCATCCCAATTATCCT
CCTTGTAACCCCATGTCTGCGTATGATGATGGTGTATCCTGCTGCTGTCGTAATTGCCAGCCCAGGTGCGAAACAAAAGCTGTGTCTTTGAGGTATCATT
TTCTTTCTAGTTCATAAACTGTTCGTGGTATCATCATCATCGACTTGTGAAATCGGGTTGGCCAAAAGGCCTCGGTTTTATCCTTTGGTTTGGTGTGCAA
AAATAGGCCCAGGTGGCCGGGCGCCTCCCGAAATATACTCCAGTACAACTTCGGTGAAGTGGTGAGTGTTTTCCGATATGGGCTGACCAATTGTTTTGCA
CTCGTTAGTGGACTTGGGCCGGATACCAACATTCATCTGGCGGAAGCAGACTCTGAAATGAGGCAGGCATAGGTTGCATGCAATGCCAAAAGGAGCCCCA
AGAATACACGTGAAAAAATCAAACCACATACCTGATGACCAAGACCAGGTCCTGGAATGGCCTGATCTTCGAGCCCAGTACCACGTAGGTAGGCCCTGAC
GGGCTCCCTTTGCCGATGCTGCTCGCGCTGCTCCCTTCCAAGCTCCTCCGTAGCAACCTCAGTGACGAAGTAAGGATCGGCTAGAGAAGCCCCCGAATGC
TGCTGCATGACGAAGCAGCGCTCCGCAAAAACTCCGTGCTCGTTCTTGCTCTTCCACGCCGGACTGAGGCGTCGTACCATGACGGGCTTCCAGCCCCCAA
TGTTCAGCGTGACTTGACGCCAGACGTTCTGGCTGGTATGCGAATACATGGCAACTGCAGCTGCAGACTTATGCCTCAAGAGTGCTGTAAAGATGTGCAT
GGCGGCTTCGGCGTCTCTATCGACCCCGGATATGACTTCGTCCCAAGGGTGCACAACCGTTCTAAGCCGCAAAAGAAGCTGTCAGACACATGTAGAAATA
GCAAGTCGTAGGATGCACTCGGTGCCAGCGATGCGAAGAAGATAGAAAGAAAATGCATGCTAGAATAATGTTCAAGGGCTCTACTTACTGAACATGCAAT
GTCAGCGTGTGGAGACTTGGGAAGCGAGCCAGCGTCTCAATGAAGGCCGGAGGATTCGTCATTAAAGTATCCATATCCAGCTCTAAAGTGTGCAGATTTT
TGAGCTCCCTCGCCAGCATACTCAAATGATCTAGCCACATGGTCGGGCATCTTCGGCTCTCGTCACCAAAGCCAATGAAGTCCCGCAGAGATAAAATTTC
CAGAGTTGCCGCGTGCACCAGCAGCGAGGCTGGGTCAAAGTGCCGCATGTCCACAGTCAACTCGAGCTTTTTCAGTGACCGAGTTCTCTGGCGAATGATC
CAGGCCAGGTGCGCCGACAGCTCTTCTCGCGTGTCTGATATTCCAGAGTCACGGGTAACTAAAGTGTGTAGTCCGTAGAGGTTGAAAGCTTCAATGGCAC
GGAGAGCCTTGAACACAGGCATGTCCAAGAGCTCTAGGGATTGGATACGTGAAAAATCCCAATGCCGAAGCACCTCCTCGCGGGAGTGACACCAGTCGTA
ACACTCGAGTCTCAGCTTCTTAAGTGGCGGCAATCGTTCTCCAGCTGAGAATGTGAACCTGGTCCCTTGCCCCTTATCTTGGTAGTGAAAAGATTCTAGC
GACCTGGAATTAAGCAGCACCTGCTTCAGCCCATTGATGCCAGTCATGAGCGGTGGACTTGGGATAGCCATCTTTAAGGATACCAATAGTTCGGTTGGAA
TCGCCTCCAGATACAGATTGTGGTGATTCTCTAGGTGCCGGGACGCAACATTTTCGAAAAAGACACGCGTTCCTCGACGTAGCCTGCCATGACTTCCGGG
AGTGGTGAGGAATAGCTGAGCAATAGGGCAGGTGCAAGCTGAGCTGGAGCGTGTTCGCGCATATCGCCATCTGATTGATCAACCAACCCAAATTAGACAC
TTAACAAGCAATGAGCCGTGTTGTTGACAAAAAGTCCTGGTCTTTGCCAAATAGTATAGCTAGGACGGACATACGTGAATGTTAACAAGTTTTGAATGCT
GGTCGTGATCCGGGCAACAGCACGATGATTATCATGGCAGCTCTCGATCTCGTCAATAGACGCAAATACATGATTGGTGTGCAGACTTATGTTTGCGTAC
GCGTCATAAATGCGCTCGGGATTTCGGAAGTAGAGAAGCCGTTTTGTCAGGACAAGGGTCTGATATTCGACGGGCGTGGCCACCTTGTCGAACCAGCGGC
AGACCAGTCTCACAGATATTATATCCCTGATACTTGACTCTCGTACCTGTTGCAAAGATGAACGAATAGCAGCCCAACCTGTTAGCATCTATGGAGAGAC
CAGTGTAGCCTTGAGAGATGTATATCAAAAAGGGAGAGAGAAATGCAAGACCGAAATGTGGGAATACTCCGCAGGCCAGCGGCAGGCCGAGTAGTGGCAG
TAATAGCTCCATATTCCACTCACATGCTCAAAAATCAAGACCAAAATCTCAGACGCAAGATTTGGAAGGCGTGTACACGTTCTCCGTTGCCTTGACCTGC
GTGCGGCAGCTGCCATGACTTGTGAGTCGTGGGTCGTCTTTGCCCTTTTCGATGGCCGTGTTGCTGGAGGCGGCGAAGTCTGCCGGCTTAAGAGTTTGGA
TAGGAGCCGGTCGCTGTGGTCTGAATGGAGGGAAAACGGGGTCCGACGGCAGACATTGAGGCTGTCCGAAGGAATTGTGTGTGCCTTTTGGGCAGGATGG
ACAGTGGCCGCCATTCCATGGGCTGTAGGATGAGCGCAAGGGATGAAAAATATAATACCTTACGTAGCTCCAATCAAGATGCCGAGAGTGGGCTGCGGGT
GAGATGTCACCTTGTTGATGCTTCCCCTCCTGAGCTATGTAACCTGAGGAATTCTCTGGGCGAAGCGAGAGGGATGGAGGAGTGGAGGACGCCTTTGAAG
GTTGCGAGGATCGCGGCGGACAAGAGGTCAATCGCAGAAGCCAAGAAATAGTAATATGGACGAATAGAAAAAGGATATGAAGTGGATGGGAATCAGACAT
CCAAACAGCTACAGGCAAGTTCCTAGGAACAGGGTGGCTGCATGGCTTGTGAGCTTGCCCTATCTGGGTGCGAAGAGCGATACTAATGCACCCAGGTCGG
CAAGGTAGTAGTAAACTGAGGGTAGGTACGGAGTAGTTGGTTACTAGGTAGGTACCAGCAATAGTAGTAGTGGTATCCACACCCTCAGAATACGCACGGG
AGTCGACAAGGGGTGCGGCTGCGGAGTGGATGCAGGCGAGGATATCAGACCGTGCGTGTGTTGGCAGATTAGGCAGTGTCTGGCCAGCCAGCTTGCCAAG
AAAGAAGGTCTTGTAACTTGGGACGAGGTTGTTATTGCTGAGGGGTGAAGCATGTGGAGTATTGGCAGGTCATTAATGGGGTACGCAGTAAGGTACCTAC
CTAGTTAATGTGGTAACGAATCGGGACTGCACGGTAATTATCATAACCAGAGTTTCCCATCCGGCGCAGGGTCGTCTTCCATGTAGCAAGGGAGTGGTCG
CACGCCACAAATGGAAAAAAAAGGAAATACAAAGAAGAACAAGGGGTTGAATAGTGGAGGCGAACGCAAGCGTTCGGGAGCTAAGTTGACTTGAGTGCTT
CATGGCGAGAACCAAAAGTATAATAAGCGCTGACGGGTCATTCCACCAGGATACATCCATGGACAAGACATGGACGGGGGATGCTCTAGCGCATCAACCA
TGGCAAATGGTTCCTCAGACGCGGCGCTGGAAGAGAACAAGGTGCCTTGCCTTGCCTTGCCTTGCTTGTGACAGTGGAGAAGTACGTGGGAAAAAAAGAG
ACGATATCAAGCTCAAGAATAAGGTTAGACTTGCTTGTGAACATTGGTGCTATGCTAGGTACAGGTAAAGGTAAGTAAGGTACCTGAAGGTACGTCGGAA
CTTGGCACCAGTACTCGGTACCCTACTAGATGTAGATGTTGTGACGGCATTGGACGGGGAGAATTAAGGATGGGACGAATGTAAAACCGTGACACTTAGA
GCTGTGTACTGTGGGCCAGGATGATGGAAAGACAAGCGCAAGTCAAGTGCCAAATTTGGGTCTGGTCGCGCCTGCATTTCGCGTCTGTTCTGCGTTTTGG
GTTGCCGGCCCCGAAAATGGAAGGAAGCAATATCTGTCTTGGTCTCAGAAATGAGAAAATGACCCGATTCGACCAACAGACCGCCAGCTACCTACACCCA
CGGACTGGTTCCAGTCTTCTACTGCTTTACCCGGAAAAAGGATGTACACAGTAGGGCTACAAGCAGCCAGGGCAGGGCAAAGCAAGGGATGTGAAGTGAA
GTGGAGATTTTGATCGTTGATTGATGAAGGTTCCAAGCCTGCTGCTGATACTACATACCTGGGGACAATATTCTTTACTCTTCTTGACGGGTTATTTTTT
CTTAGTTCGCTGCAATACGTTGTTTTCGGCAGCTTAGGTTGCATATTTGTCAGTTTTGCGGAAAGTATACCAAGTACCTTGGCTACCTCAAGAAATCTCG
ATGCAAACTTGGGTACCGGTGTTGTGTTAGGGGGCAGCCAGTCTCTGCCGTCCAGTCTCCAGCCGGAGGTACGGTACAGAAAGAAGAAAAAAAAATATCT
CAAAGTTCGCAAGTTTCGCCCAAAAAGGCAAGTTGGGAGAGCCCGTTAGATCGCCGTATCCCAAGGTCGTGGAGACCCTGCCCGCAGCTGCAGCTTCGAA
AGTGGGGTGGATGTGGGGTGGAAGGAATCCACTCGAGGTTCTTTCGTATATTTTTATTTCGACTGCTTCTCCTTTCCCTTTCCCTTCCCGCTTCATACAG
AAGACGAGAGGAGAGCTTCACCTTTGTCTGAAATGAATCATTTACCCGGTAAATATCAAACATCCACCCGGGCTTGACAAGCCCCGATTTATGGTTGCAC
AGATCGGCAGTTGTTTCCCTAGAGAACTTGTTAGCAGCGTTGGGGAAAAAAATCAACGTCCTGTGGATTCACACTATTGATGAGACAAGGTTTCGAATAT
TTATTCAATGCTACTCTCCTGGTGAGCCGCAGCGTTGGAGCTGACGTTGTACTTTGCGCTATGGGGTTGGCTTGGATGGCGTCGATCCGGAAACGGGTCC
GCTTTTCGAAGAAATCGTGACACCAATCTGCCGCAGCACCGCCAAAACCTAACAGCTTGCAGAGCTCTTTAGTATTAATCGCCAGGTCACCGCTATAGAT
CAGCTAATGCTATAAAGACTGTACCTTGCAGTCTTTATCGAGACTGCTGTTTGTACTCATCGGAGATTCACTATCTTTTTTGTTCGTTGTTCTACACAGG
TTTTTGTCATCTTTTCTGGTCTCCTTTGGTAGAGTTCCTCTGAACTTGACCATGTGCGCGCGGGCCGCTAGGTAATGTGGGCCTACTAGAACTACCACGC
TCTAGTTGAGCTACTATTAGATTCCCTGGGCTGTCCAATCGCATTCCTCGCAGCAGAGGGGCCCTCCCGACATCGTCGGGAGCTGCAAGCGTGCAGCAGG
CACCTGTGTGGGTGAGGTAAATAGCGGCTTGGCGCCCCAATGTTCGTCTTGGAAATCCCATTTCTCCAACCTCTTTATCCGGCAGAACACCTAAATTACC
AATCGCACCACCATGGTAATGCCGCGAATCACTTCCGAATATTCAACATTTAATTCTAGTTGCCACAGAAAGAAAGAAAAATGTATGTATTTATGTAAGT
ATATGCACATTATCTGTTGAGCGTCGTCATGGATATTCCAGGGCTCTATCCTCATATCGGCATAAATCTTGGCAGTCTGTTACTGTCTTCTCGGCGTCTT
TAATCCAGAGTAAGCGTACCAAAACAACGCTTGACTCGATTATGACTTGATTGTACTTCGTAGTACAGGAAATCACCCGGACGAGATCCACACCGTTTTA
CAGCTCCCCTCTTAGCTGCCAGTCGCAACCACATCATCCCGCCACGTATGACTCCTGTTCGATACCGCCTTGGCATTCGAAGTTTACGGTACCATGGTTT
ATCATCGATGATTGAACTTGTCTTATGGGTGTCAGTGTGTCACTGTTTCTGCGGCGTCAATGTCCCCCACCTTTGGCTAGCGCGGGTTCGCGTGCGTTTG
ATGGGCTTTCTGGAACCAATCGCAAAGATAATACAAGGCAGAAAGTTAGTTTTTTTGAGAGGAATATTTGTTGGTAAATTGGGTACAGTATGGGAAAACA
GAGCTGACCTAGAGCCAAGGTATGCGGCCAGGGATAAGAAACTCACTCACACTGGACCCAGCAATGGACGAAGGGAAGCAAGGCGACTGGTCCGATCTCT
GTGTTATAGTATCCATTCATTCCAACTATTCCGAACTCCGTACCTAGGTGCTCCGTAGTTGTCTTCCTTGCCTTACCTGCATGTGCATGCAACCCTAGCA
TGCCCGCTTGCCGCCTAAAACCAGCATCCCAGAAATGCGAGTGGCTTAATACCTGCCAATAAGCAGATTCATTCGTACATTGTTATAATAAATCTTCCTT
TTTGCCACGAGGTCCAAGCTCCAATTGCTCCCTTGCAACGTTGCTACCTACTCAGCTAGGCTTTCTAGGTTGTCAGTAAGATCGGTGATTTCCATGGGTG
GCATCAAAACAACAAACAAAATGGACCCCTGCTTGTGCTTACTTTTTTTTCACAATCTGACTAGCAAGCTTGCGAGGCTTGGCAGCAATCGTACCGGTAG
TATTGATAGAGGTAGACCAAGAAAGGCAATATTAGCCCTCAAAGCTCGCAAACAACACACCGTTTTTTTTTTTTTTTTTTTTTTTTTTTTACCAAGACGT
Copyright 2006 Fungal Plant Pathology Lab. & FBL
E-mail : yonglee@snu.ac.kr
Magnaporthe oryzae ATMT Database