Home   Guide to ATMT Database   Sitemap   Contact  
Sequence ID  5333237
Locus Name  MGG_02817.5
Gene Name  
Protein Name  hypothetical protein
Species Name  Magnaporthe grisea [Magnaporthe oryzae 5 PROTEINS]
Protein Sequence
[572 aa]
+  1
101
201
301
401
501

MVLSRHVNPDDIVQHLHNSSLKEQDGDNDTRTQAAISHLTPYSSRYASNVSLPKYKLPKEGAEADTVYSMIRDELDLDGKPNLNLASFVGTYLEDNAQKLMVENIAKNLSDADEYPAMISMQQRCVSILAHLWNVQKGEKAIGSATTGSSEAIQLGGLAMKRRWQEARRAAGKDDSKPNIIMGANAQVALEKFARYFDVEARILPVSEKSRYRLDADMVRDNIDENTIGIFIILGSTYTGHYEPIEEISEILDKYQAETGHDIPIHVDGASGAFIAPFTHAQAGGPKWDFSLPRVKSINTSGHKYGLVTAGVGWIVWRDESFLPKHLIFELHYLGGTEESYTLNFSRPGAQVITQYFNLVHLGFSGYRAIMENCLANARLLSKSLEATGWYTCVSDIHRRVETAGSNGSNGKQKEPEVTPEHAKETSADYVAGLPVVAFCFSDEFRRQFPHVKQETVSVLLRARQWIIPNYALPPNEEKTEILRVVVRESMSLDLLDRLLSDICEVTQKLMDEDELDLNVLQGSRHKGPCTKADVSKEGRAQAKKERDDRHKKHQATGRTGRMETGVHRSTC
MVENIAKNLSDADEYPAMISMQQRCVSILAHLWNVQKGEKAIGSATTGSSEAIQLGGLAMKRRWQEARRAAGKDDSKPNIIMGANAQVALEKFARYFDVE
ARILPVSEKSRYRLDADMVRDNIDENTIGIFIILGSTYTGHYEPIEEISEILDKYQAETGHDIPIHVDGASGAFIAPFTHAQAGGPKWDFSLPRVKSINT
SGHKYGLVTAGVGWIVWRDESFLPKHLIFELHYLGGTEESYTLNFSRPGAQVITQYFNLVHLGFSGYRAIMENCLANARLLSKSLEATGWYTCVSDIHRR
VETAGSNGSNGKQKEPEVTPEHAKETSADYVAGLPVVAFCFSDEFRRQFPHVKQETVSVLLRARQWIIPNYALPPNEEKTEILRVVVRESMSLDLLDRLL

DNA Sequence
[1719 bp]
+   1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
ATGGTCCTCTCACGCCATGTAAACCCGGACGACATTGTCCAGCACCTGCACAACTCGTCTTTGAAGGAGCAGGACGGCGACAATGACACGCGGACCCAGGCTGCGATTTCCCACCTGACGCCGTACTCGTCTCGCTACGCGAGCAACGTGAGCCTGCCCAAGTACAAGCTCCCCAAGGAGGGCGCCGAGGCCGACACGGTCTACTCGATGATTCGCGATGAGCTTGACCTGGACGGGAAGCCGAATCTGAACTTGGCCAGCTTCGTGGGCACCTACCTCGAAGACAATGCCCAGAAGCTCATGGTAGAGAACATTGCCAAGAACCTCTCCGATGCGGATGAGTACCCAGCCATGATTTCGATGCAGCAGCGCTGCGTGAGCATCCTGGCCCACCTCTGGAACGTCCAGAAAGGAGAGAAAGCGATTGGCAGCGCAACCACAGGCTCCTCGGAAGCCATCCAGCTCGGCGGTCTCGCCATGAAGCGCAGGTGGCAGGAGGCGCGGAGGGCCGCCGGCAAGGACGACAGCAAGCCCAACATCATCATGGGCGCCAACGCGCAGGTCGCCCTCGAGAAGTTTGCCCGGTACTTTGACGTCGAGGCGCGCATCCTGCCCGTGTCGGAAAAGAGCAGGTATCGGCTCGATGCCGACATGGTGCGCGACAACATTGACGAGAACACCATAGGGATTTTCATCATCCTGGGCAGCACCTATACGGGGCATTATGAGCCCATAGAGGAGATTTCCGAAATCTTGGACAAGTACCAGGCTGAGACTGGGCATGATATCCCAATCCACGTTGATGGTGCAAGCGGTGCTTTTATTGCCCCCTTTACTCATGCACAAGCTGGTGGACCCAAGTGGGATTTCTCACTCCCCAGAGTAAAATCCATCAACACCTCGGGCCACAAGTACGGCCTTGTGACGGCCGGCGTTGGCTGGATCGTCTGGCGCGACGAGTCCTTCCTGCCCAAGCACCTCATCTTCGAGCTGCACTACCTAGGCGGCACCGAGGAGTCGTACACGCTAAACTTCTCGCGGCCCGGCGCCCAGGTCATCACGCAGTACTTTAACCTCGTCCATCTGGGCTTCTCGGGCTACCGGGCCATCATGGAGAACTGCCTGGCCAACGCGAGGCTGCTGTCCAAATCTCTCGAGGCGACGGGGTGGTATACCTGCGTATCCGACATCCACCGCCGCGTCGAGACGGCCGGCTCCAACGGCAGCAACGGCAAGCAGAAGGAGCCCGAAGTGACGCCCGAGCATGCAAAGGAGACGTCTGCCGACTACGTGGCCGGCCTGCCCGTGGTGGCGTTTTGCTTCTCGGACGAGTTCCGGCGCCAGTTCCCACACGTCAAGCAGGAGACGGTGTCGGTGCTGCTCCGCGCACGCCAGTGGATCATACCAAACTACGCGCTGCCGCCCAACGAGGAGAAGACGGAGATCTTGAGGGTCGTGGTCCGCGAGAGCATGTCGCTGGATCTGCTCGACAGGCTCCTGTCCGACATTTGCGAGGTGACGCAGAAGCTGATGGACGAGGACGAGCTCGACCTCAACGTCTTGCAAGGGAGCAGACACAAGGGGCCTTGTACCAAGGCCGATGTTAGCAAAGAGGGGAGAGCCCAGGCCAAGAAGGAGAGGGACGATCGACACAAGAAACACCAGGCCACCGGCAGGACGGGCAGGATGGAAACTGGTGTTCACAGGTCGACCTGTTAG
CTGCGATTTCCCACCTGACGCCGTACTCGTCTCGCTACGCGAGCAACGTGAGCCTGCCCAAGTACAAGCTCCCCAAGGAGGGCGCCGAGGCCGACACGGT
CTACTCGATGATTCGCGATGAGCTTGACCTGGACGGGAAGCCGAATCTGAACTTGGCCAGCTTCGTGGGCACCTACCTCGAAGACAATGCCCAGAAGCTC
ATGGTAGAGAACATTGCCAAGAACCTCTCCGATGCGGATGAGTACCCAGCCATGATTTCGATGCAGCAGCGCTGCGTGAGCATCCTGGCCCACCTCTGGA
ACGTCCAGAAAGGAGAGAAAGCGATTGGCAGCGCAACCACAGGCTCCTCGGAAGCCATCCAGCTCGGCGGTCTCGCCATGAAGCGCAGGTGGCAGGAGGC
GCGGAGGGCCGCCGGCAAGGACGACAGCAAGCCCAACATCATCATGGGCGCCAACGCGCAGGTCGCCCTCGAGAAGTTTGCCCGGTACTTTGACGTCGAG
GCGCGCATCCTGCCCGTGTCGGAAAAGAGCAGGTATCGGCTCGATGCCGACATGGTGCGCGACAACATTGACGAGAACACCATAGGGATTTTCATCATCC
TGGGCAGCACCTATACGGGGCATTATGAGCCCATAGAGGAGATTTCCGAAATCTTGGACAAGTACCAGGCTGAGACTGGGCATGATATCCCAATCCACGT
TGATGGTGCAAGCGGTGCTTTTATTGCCCCCTTTACTCATGCACAAGCTGGTGGACCCAAGTGGGATTTCTCACTCCCCAGAGTAAAATCCATCAACACC
TCGGGCCACAAGTACGGCCTTGTGACGGCCGGCGTTGGCTGGATCGTCTGGCGCGACGAGTCCTTCCTGCCCAAGCACCTCATCTTCGAGCTGCACTACC
TAGGCGGCACCGAGGAGTCGTACACGCTAAACTTCTCGCGGCCCGGCGCCCAGGTCATCACGCAGTACTTTAACCTCGTCCATCTGGGCTTCTCGGGCTA
CCGGGCCATCATGGAGAACTGCCTGGCCAACGCGAGGCTGCTGTCCAAATCTCTCGAGGCGACGGGGTGGTATACCTGCGTATCCGACATCCACCGCCGC
GTCGAGACGGCCGGCTCCAACGGCAGCAACGGCAAGCAGAAGGAGCCCGAAGTGACGCCCGAGCATGCAAAGGAGACGTCTGCCGACTACGTGGCCGGCC
TGCCCGTGGTGGCGTTTTGCTTCTCGGACGAGTTCCGGCGCCAGTTCCCACACGTCAAGCAGGAGACGGTGTCGGTGCTGCTCCGCGCACGCCAGTGGAT
CATACCAAACTACGCGCTGCCGCCCAACGAGGAGAAGACGGAGATCTTGAGGGTCGTGGTCCGCGAGAGCATGTCGCTGGATCTGCTCGACAGGCTCCTG
TCCGACATTTGCGAGGTGACGCAGAAGCTGATGGACGAGGACGAGCTCGACCTCAACGTCTTGCAAGGGAGCAGACACAAGGGGCCTTGTACCAAGGCCG
ATGTTAGCAAAGAGGGGAGAGCCCAGGCCAAGAAGGAGAGGGACGATCGACACAAGAAACACCAGGCCACCGGCAGGACGGGCAGGATGGAAACTGGTGT
Position in Contig 1340790 ~ 1342975 (2186 bp, 467 bp) in Magnaporthe grisea 70-15 supercontig 5.193 (Strand -) (Frame : -3)
Chromosome Chromosome : Not defined!
Contig Sequence
(1330701 ~ 1352900)

+1330701
1330801
1330901
1331001
1331101
1331201
1331301
1331401
1331501
1331601
1331701
1331801
1331901
1332001
1332101
1332201
1332301
1332401
1332501
1332601
1332701
1332801
1332901
1333001
1333101
1333201
1333301
1333401
1333501
1333601
1333701
1333801
1333901
1334001
1334101
1334201
1334301
1334401
1334501
1334601
1334701
1334801
1334901
1335001
1335101
1335201
1335301
1335401
1335501
1335601
1335701
1335801
1335901
1336001
1336101
1336201
1336301
1336401
1336501
1336601
1336701
1336801
1336901
1337001
1337101
1337201
1337301
1337401
1337501
1337601
1337701
1337801
1337901
1338001
1338101
1338201
1338301
1338401
1338501
1338601
1338701
1338801
1338901
1339001
1339101
1339201
1339301
1339401
1339501
1339601
1339701
1339801
1339901
1340001
1340101
1340201
1340301
1340401
1340501
1340601
1340701
1340801
1340901
1341001
1341101
1341201
1341301
1341401
1341501
1341601
1341701
1341801
1341901
1342001
1342101
1342201
1342301
1342401
1342501
1342601
1342701
1342801
1342901
1343001
1343101
1343201
1343301
1343401
1343501
1343601
1343701
1343801
1343901
1344001
1344101
1344201
1344301
1344401
1344501
1344601
1344701
1344801
1344901
1345001
1345101
1345201
1345301
1345401
1345501
1345601
1345701
1345801
1345901
1346001
1346101
1346201
1346301
1346401
1346501
1346601
1346701
1346801
1346901
1347001
1347101
1347201
1347301
1347401
1347501
1347601
1347701
1347801
1347901
1348001
1348101
1348201
1348301
1348401
1348501
1348601
1348701
1348801
1348901
1349001
1349101
1349201
1349301
1349401
1349501
1349601
1349701
1349801
1349901
1350001
1350101
1350201
1350301
1350401
1350501
1350601
1350701
1350801
1350901
1351001
1351101
1351201
1351301
1351401
1351501
1351601
1351701
1351801
1351901
1352001
1352101
1352201
1352301
1352401
1352501
1352601
1352701
1352801
AAAGGAAAAGTACTCCAAGTTCATGGGAGATCTGCAGAGTATGTCTTCGTCAGCACATCATCTCACTCAGTGAGATAGGGCATAATTGGCTAACCCGACG
CTTCCCACGTTGCAGGCAGAGGCTTCAGCATAACATACAGCACACCCAAAAGTGATTCTCTCAAGCTTTCCCACTTGGGAGAGCGGGTTTTTGACCATGT
CATTATATTCCCGACCAAGTCAAAGGGTATGCAGTTCAGTCTTTCAGTTCCAAGTACATCGTGGTGAGGGCATTATGATGGCGGGGTGGTGGGTGGCCAGGTACAAAACACTAAATCGGACTTACGACTGACGTTACACACCTTTGACCGACAAAGGTCTTGGCCCCAACTTGACTCCCGCTCTTCTCCTCCAGTTCGTCAAGGATGAGGGCAACGTTATGTTGGCTCTTTCTGCCGAAACCGCCGTGCCCATCTCGATCGTTTCGCTTCTCCACGAGCTCGATATCCAGCTCCCTGCCGATCGCACCGGTCTTGTGGTCGACCATTTCCACTATGACAAGATCTCTGCCGCTGAGAAGCACGATGTCATCCTTGTCAAACCCAGGCCGGTTCGTGACTTCCACAAGGACATCTTTGGCAGCGAGAAGCAGACCAGCCAGCTGCTTGCGGTTCCGCGAGCCATTGGCCAGACCCTTGGCCAGAGCCCCCTCCTGAACCCTGTCCTTCGCGCCCCTCTCACCGCCTACAGCTACGATCCTAAGGAGCAATCGGAGGTCGTTGATGACCTTTTTGCTGCCGGCGAGCAGTTGAGCCTCGTCAGCGCTGTGCAGCCGCGTAACTCGGCTCGCGTTACAGTCGTTGGCTCTGCCGAGATGCTGCAGGACCAGTGGTTTGATGCCGAAGTCAAGCCGTCCAGCTCAAACAAAAAGGTCTCGACCTACAACCGCGAGTTTGCCAAGAAGTTGAGCGGCTGGACCTTCCAGGAGTACGGTGTCCTGCGCGTCAACTCTGTGGAGCACCACCTGAACGAAGCGGGCGCAAGCAACGTTTCGAACCCGGCTATCTACCGGGTCAAGAACGATGTGGTAAGCTAGCAGCGGATGCTGTTGTTTTTACGTGTTAGTCTTTGTGATTTTTTGCATACTGATCAGGCTGGACCGTAGACCTACACCATCTCTCTGTCAGAGTACAAGCCCGAAACTCAGTCCTGGGGACCATTTACCGTTCCGGATGGCGATGAGATTCAGCTGGAGTTTTCCATGCTGTCGCCCTTCCACCGCTTGGGCCTCAAACCTACGACCTCCACCGAAAGTGATGCTACCAAGTACAGCGTGTCTTTTACGCTGCCCGACCAGCACGGCATCTTCAACTTCCGTGTCAACTACAAGAGGCCATTCCTCACCTACATCGACAGCAAGGACCAGGTCTCGGTCCGCCACATGGCCCACGACGAGTGGCCACGCTCGTTTGTCATCTCAGGCGCATGGCCCTGGATCACTGGTATCGGCGCCACCATCACTGGATTTTTGGCCTTTTGCCTGGTTTTCATGTTCAGCGCACCCACTGGAAAAGCCACCGTTACCAAAAAGACTCAATAAATTGGGAATTTTGGAGAGGCTTTACTACAAGTGCCAGAGAAGCCTGAAGCTTTGGACGTTGAACCTCTTAAAGCGATCAAGGCTCCAGGGCAGGTCACGTCGTGCCGGTGCTTAGTGGCGTTTGTCTGTCACTAGTATCCGCTACTGGAGCATATTGCAGAAATTTGGATGGCTCACTGGAAAGGCTGAGGAAGTTCGATTGATGACTGATGAGCTGAACAGTCTTTATTTACATTTTGAGCCAGCTGTATGTATAATTCGGAAAATGGGTACCATAGGAAATAGGCCATTTGGTCATGGCCGGTTATGAGACAATTATGCAAGTGTCTCTTAGATTTTTCACTTTAAACATTGCAGTTTGAAAGTACTCCGTTGATGCGAAATCAAAGAAAACTTTTGCCGTGGTAATGATGTGACTTGTGACTGTTTACAAAGTAAGGGATGAAAAGTGTGTTTGAAAATTGAATGACTTGATGTTTCTTTGAATACTTTATATTTCAGGTTATTGAACGTCGCTGTACAGATCCCAATCCTGCCCAATGTCATGGCTGAAACGAACCACTCCATATCATAGGACCAAGAGTAGGAATTTGATATTCATTTTTGTACCTTCAATGTCCACTCAGATAGAGAGAAAAAAAAAAAAAAAAAAAAAGATGCAAATAGCAACTGTACCGGATATCTGGTTACCCAGTGCAGGAAAACTTGAAAGAGACGTAGCTACTTACTGCAATATAAATTGTCAGCGTCTTCACAAGCTTTAATTGCAACACGACGGGAAAAATGAAAAGGAAAAGAAATTACAAAGGTGCCCTCAGATTAGCTCTCTCAAGTTCTCATTGACCCAGCAGGCAAGAGCCGCCCAAAACCTCCCATTCCATACCGGGCCGCGCCTCGCAAAGGGACCAGCAGCAGGAATCAGTGGTTGGGCAGAACTCGAGCCCTTGAAGATGCTGAAGGTCTGCAAATTTGGCTTTTTGGACACAATGTCATCACCGGGCCTTTGTGTGATTTCTTGACAAAATGAAAAGAAAACGGGGGGAAATGAGGACCTTGACCGATTTCACCCCCTTCCATCCTCAAAAAATAACAACAAAACAAAAACAAAAATGAACGGCATCTGATTGAAAACTACAATATTTCTTTGGGTCATCGGTTCACCTCCCTCATGAACCACAATTAGGGCCCGCATTCCTGCTGAGAACAAGGTTCCCAGAGTAGCTTGGGGGCATGGGTTGGCTGAGAGAGGCTTTGGGAACCTCGAGAAAAGCAGATTGTCGTCATGGCCGCTGTGTCTTTTCGGCTTTGCCATGTCGTGTAAAGTGGGATAGATAAAGGGGGTGGAATCGGGGGGAAAGGCTCCTCGCTGCTCAGATCTCTGTTCTTGTTAGGGGCTCGCATCGGCCATGGGGAAACGCAGATGCCCAATAAAAGGCTGATCGGTTTGCATCCCATGCCTAAAGACTAGCATCTACGTGATGGGTTTGTCGTCATCGCAGGGGCGAGGATTGTCCCAGATGCTGGCAGTTGGGGTGTGATGAAGGAAGACAGAGAATGGTGAGATGGCCGTTGCTTGAACAGCTAGGTAGCTTCCTGCCTGACTGAGGCTGGAGCTTGGAGAGCAAGTAGCCGTGAATGATATGAGAAGGATTGAGCTTACCCTTTTGTCACGTTGTCGCCCAAAGATAGTCAAGTATATGAGATTGCCCTTTTCTGAAGACTGTTATTTACCTGCCTGTTTTACCTGGGTTTCAGAACTGGGTCCCCGACCAGAGAGAACTTTTGAGGGTACAAAACATCTTTGAAGGTGGACGAACGGTTGAATGATTGAATTTCCAGCGCGACGATGAACGCGTCCTGCAGGCTCATGGCCCACTCGCCCAACCCACAGTAGGTGAAGGCCCCCACTAAAGAAGTTCACAAATCCCCGCATTTATTTCTTATCGATATCTCATACCGACATGGTTCTGTCGTCGGTGAAGACAATCCAACGGTAATGACCCGCGTCTTTCGCCGATTGTGAATCCCGCCCCCAAAAAAAGACCCGTTCCGACAAAGTTGCCAGTCCGCTGGTGTCGTGCTTTGCTCAACCTTCAAATCTAGCCGCCCCGAGGCCTATTCTGTATCTGTCCACGACAGTCTTTAGCATACAAGGTCTCGGTCGCACAGGCGACAACCCGCCGGCAAGATGGTAAGGCACCTCTCCCTCCCCCCCGGATAATGCTCCGTGTCCCCAACGTTGCTAACCCCGTTCATTTTCCCCGTTCCACCAGGCGCGCAACTCAGAAAAGGCGCAGTCGATGCTCTTCCGCTTCCGCGAGGCGCAGGCGGCGGACCTGGGCATCATCGACGCGGGGCGCACGCGGCGGCCGCGCGCCATCACGGAGCAGGACTCGATCCCGGCGTGCGAAAAGTGGCGCGGGCAGGTGCTCAAGGACATATCGCGCAAGGTGTCGCGCATCCAGGAGTCGTCGCTGTCCGACTACCAGATCCGCGACCTCAACGACGAGATCAACAAGCTCATGCGCGAGAAGCACATGTGGGAGGTGCAGATTCGGAACCTCGGCGGGCCCAACTACACGCGCGCCGGCGGCGCCAAGGTCTACGACGAGGCGGGCAAGGAGATTGGCGGCGCCGGCAGGGGCTACAGGTACTTTGGGCGGGCCAAGGAGCTGCCGGGCGTCAAGGAGCTGTTCGAGGCCGCCAGGGCCAAGAAGGGCGACGAGAAGCCCCTCGAGGCCAGGGACGACTTGAGGAAACAGGTCGATGCCGCGTACTACGGCTACAGCCCGGACGAGGAGGACGATGAGCTGCTGGCGTATGAGGCCGCCAAGGAGAAGGAGGCCTTTGAGAACCTCGCCGACAACAGGAAGGGAGAGCAGCTTCCTCCCGGTTGGGAGCCTCTGCCGGGCGATAATGGAGACGGGAAGGGTTGGGAATTGCCAACGGTTGAGGAGGTGCAGCAGGAGCTAATAAATCGGAGGAAACAGAGGCTGCTTAATCAGTTATAGTTGGCTGATGCCATCTCGGAGCTGTGCCTGTGTAATGTGGGGGGGGGGGGGGGCGTTTGGCGTCTAGGGGCTGCATTTGGCTTTAATTCTATTTCAACTTGAACACCAACGAAATCTTTTCTGTCTTGGTTGTGTGGATTGCGTAAATGTATATATCACACTAAGCTGGGGTTAATCTACCTCGTTTGACATTATATGAGAAGAAACAAAAGAAATACCGGATATATAAAGTGTGCCAGTCCCCAACGCCTAATAACCACAATAAAATCAATAAACAATCTTCATTCTTGTACAAATGAGCTGTTCAGCAGTCTCCCTTCCAGTTCTCCTGGATCCAGTCGGCCATCATCTCGGTAAAGGTTCCGTTCCGATAGACACCAACGTCATCCGAGGTATAGTCGCCTCCCGCAAACTTGAGGGCGAGCAAAACCCACGGCTGGATGAAGCTGATGAAGACAACGTCCACCTTTTCAGGGTTCTTCTTCTTTCCGTCATCATCGACGGGAAAGCCAACCTCGGCCTGGACACAGTTCGGTACTCTATAGAATGACAATGGCGAATGCACCGCATCGTCGCCATCATCAGATATGTCGTCCTTGGTTGTGTAGCCACCAATCAAGGCCGGTTTGTGTTTATCATGATGGCTCAAAGGCTTCTGGTCGAAATCCTCAGCGGTGAATGAATGAGACGGGGTCGATGTCGAGTCGGTGACGACGACGTCCTCGGTACGGAACCACTGCTCTGGTGAGGCCATGAATCGCAGGTCTGGCACACCTTGTCCGGCCGCAAGAATCGGTCCGCCGTTGTTGAGCAGCTTAATGAGCTTTTGGGCAACCTCATATGGTACATCCTTGACGTAGTTCAGTCCCGAGGTGAAAGGGCTGACAATAAAAGTCGAGTCCCTGGTAAACGGGCCCTTGAAGATGTCGAACCTTATCCCACCGGTGTTCAAGATAGCCAGCCGGGAATTGTTCTTCCTCTCTTCATTGACGGCGACTTTTGGCAGCACTTCCGTTTCCAGCCAGGTATAAACGCTCTCATTTCCAGGGTAAGGAGCGCGGTTCATCCAGTAGGTCTGAGGTGCACATCCGTACTTCTCATCCAGCTTGAGCTCTTTTCTGGCGGCCGTAATCATTTCAGTCACTTCTTGGCCCTTCTTGGTAGGAAAGGTGGACTGGTTGAGTCCAGTGTGATGGTACAACCCCAACAGGTTGTTGTCGATGTACCGCCTCTGGAATTTGACTGGCGTCTTGCCCTTGGTAGTGTCTTTGTAGAGCCCATCTACCGACATCCACCCTATAGTCTCAAAGTACCGACCACTTGCGATAGCATAAGCGCCGTCGTCGAACTTGACGGCGTCTCTAACATGCGCATGTCCTCCAAAGAAAGCAATTGGAGTGAACCAGTTTTGCTTCCGGATCTCTGTAAAGATGTGCTTAAACTCTTGCATCCGTAACCCGACGTGTCCAATTATGACAAAGATGTCAGGCTTCTCCTTGATCGCATTCTTGAACCACTCTTCCTCGACAGTGTCCTCAACAGGTTGTACGACTGTGTTGTTGGCGTTACCGGTAAAGTCAAACAGAAAACCCATGGCTAGGACGTCCATCTTTTGGTTCTTTGTTTTGAATCTACGAAACCGCTGAGCCATGGGTTTCTTCTCGCCCGTCTCTGGGTGTATGTAATCGAGGTTGGAGGCGATGTACTTGTCCTTGAAGTTCGGGACAGTCTGCGACCATTCGCGGTCAGCGGCGTCGGCTTGGTAGAGCTCATGGTTGCCGGTGCAGATGATATCAATGTCCTGCCGACGGAATATGTCGTAGGTGAAGCGGCCCTTGGGGTCCGAAGAGTCGTAAAGCCCGTTGCCCTCAATCCTGTCGCCCGTGTCGACCAGCAGCAAGTCGCGGCCTTCCTGGTCGGCGCGGTGGCGGAGGTGCTCGGCAAAAGAAACATAGTCACCCCAGTCTGCCGAGTACTGGGACTCGAGGAGGTGACCACCGTGCCAGCCGTGGGTGTCGGTCGTGTGCAGAAAGTTGAGCTGTGCCCACTGGAGGTCCCTCATCGGAGCTTCAACCGGTTTGGCTGCTCCAGGCTGGGACGCGCGCCCGACCGTGGCCAGCGCGGCCGTGACGCATCCGACTAGTGTTGTTCTAAAAGCCATTGTGTGTTGCTCTGATAAAATGATGAATGTAACGAGATGGATTTATGACGGCCAGTTCATTGTGGGGGTGCTACTAGGACGGCTGTAGATGCCAGAATAAACAATAACGGCAGCGTTGAAGGAAACTGCACGGATTACTGTGTGGCGTCATTCATTGTAGAATTAGGACGGTAGATAAAGCTCATGCAGCTCGAGTGCAGACGACGTGGGAACTTCAGGCAGGAACCCTGATGGCCTGGTGACGTTCCCCTCGCGCCAAACATTGCCAAGGGCCAAGATTGCAAGGGTCCGTGGCCCGCTTGACCTGCAGTAGCTGCGGGGATCCGATCCGTCCTCGGATCAGAGCGTATTTGGAAAACTCGAGATTGATTCGATTCCCCTTGACTGCAATTCCATTATATATTTCAACACATCTCTATTCTGATCGTCATCGTAATGAATAAAACAAAAGACTCAAAATAATGTCTTGTCTCGCTTCTTGAAGCATCAGCTTGTGCTAGGCAGCAACACACAACACAACAAACCGGATACCGTACCTTATCTACCACACCCACAACTCAAACGCGACAGAGTTTGCCATCCACTTCCTTCCAGCGCTCATTCCCCACACATGGATGACACCAAAAGACATCATCTGGATCAACATCTCTCTTAATGGTCTTTAGCCGATCATAGTTTGAGCCCCAGAAAGCTCTCTGAAAGTTGGGCTCGTATGCATTTGCCTGCATTCATTTTCTTCGTCAGCAAGGCCATTCTCTTGGGGCACTTCACTGCACTCTACAGTTTCTGTTCGTAATGGCGAATAGCTAGGCTCACCTCGTTCATGTACGCTCCCATGTCCGGCGCGAGGTCCCTCAAGGCCGCCACACTTTGGTCGACTGCTTTGATGGCCTCGGCTTTGGCAGTCGCATTCAACGGCGGGAACCCCATTCCACAAGCTATTTTTTGAAAGACTTGGTGTAAGCATTGCAGCACCCGACAAGCTCAGTCATGTCGGCAGAACGGAAATAGTAGTATACTCACTGGCATGGAGATACGCCCTCCTCCAAGCTGGCAAGACTGCGTTTCCGCCGCCCCTAAGCTCTCCGTCCCTAACGCCCTTGCCGGCCACCAGATGCAATGTCGCCCATCCCCGAACTGCAAAGCGCTGAAAGGCGTCTTTGAGCTTCTCTCGGCTTCCAGTGAGCGCTTGTTCGTCAAGGAGCCAGCTTCCTGCAAGCCCGTTATCGCCCACCGGGTTGGAGTCAAAGTGAACCTGGATCCAGTCCCAGAAGCTACTGTAGTGTCCCATTTGGTTGGCGCTCAGGAACAAGCCAGGCCAGTTAGCTTGAATGTAGGCGTCGATGGGTTGCCAAGGGTTAGCGACGCTGCCATTGTTCCCACCCGGAATGGTGAGGGCACCAAAGAATCCCGTTATTGGTCCATCTACACCAAACCCGGGGACTGTGAGATTGACCACGGGATACAAGTATCCAGAAACTCCAGCCTTGCTCAGTCGAGGCATCTCGCTCAAGATGTATGCAACTAGATCCCAGATGGCCGTTTGGTCGTCTAGGAGGGCGGGGTTTTGGAACAGGGCAACTGTCAGGGAGCTGATCTGAGGCGTTGGATATGTTTTGAGGGTGGCTGAAGTGATGATGCCGAAGGTCGAACCTCCTCCCTTCACCACGCGAATCTAATGTCAGTCTCGGACAAGGAAGCAGTACAGGTTTGACGCGAAAATACTTACTCCTCGCATCGCCCAAAACAGTTCTTTGTTATTGCACTCGTTGAGCACCTTTATATCTCCTGTTGGAGTCACGATTTCCAACTCGAGGACCTGATCGGCGGCGAGTCCATACTCGGTGCTCAAGAGAGAGTGCCCGCCGCCAGTCAGATACCCGCCCACACCTACTGTGCTTCCGCTGCCCCCAACGACAGCCTCGTCGAACCTACTGGCGAACTCGTGGACCTGTTGCATCCGAGATGCTGCCTTGACGGTTATGGCGCTGCCGCTGTGTACGGCGCCATCTTCACTGCAACACTTGGGTTTGAAACTCCCGGCAGAGTGGTGTTGCATTCCTGTCAAATGGTGCGTCCATATCGACAGCGAGTTTGGCGCCACAGACCGACCGACATAATCGTGCCCTGTTGCTTTGACAACCAGTCGAATATTGTGCTTTTTGGCTACAGTGAAAAGCTTGTCAGCTGGCCCAGCTGGAAAATGCGAACGTATCATGTCGACCTCGACAAAGAACCTACCAAACTTGACACCAAGCTGGACATGCTCAACGGCCGATGCATTGACAACATAGACTGGATATCCACTTCCGCTGCATGGAAAGCTTGGATCCGGCAGGCAGGAGTCGTTGGTCCAAGTGTTGCCCATCATGGAAACCGGGTCGTTGACGTGGAGTGCAAAGCCCTGCCAGCCGCCGGTCTGGACTGCAGCACAACGCTCGGCATTATAAGAGGGCTGGTCTGGATGACAGACGGCACCCGGAGGAGTTGGTCGAATCAGTTGACCGCCCAGTGAGGTGTTGAATGCCTGCCACTGCTCCTCGGATGGCCACTCGTGGGCGCCGGGCACGGCTTTGCATCTCGGGGCTTCTCGCTTGTGGTGATCCTCAGCAGAGACGTGCGCTGCTAGCAACGGCACAACGTGGGCCAATATCAACGGAACAAGCATCTTCTCGGAATTATGCAAGAACATGAAGGCTGGGCTAATGGTTTATTTGTGCCTTGAGGGTGTCTCAAGATGAGGAAAGAATGCCTCCCGACGACTATCTACACATCCGACCCCAATATGCAAACTCTGGACATTCCTCTCGTTTATTTATACTGCTCCTATTCATTCGGAAATAATAGGAAACATTGCGACAAGATATAGGGTTCAACTCCACGCGGCCGGCCGGGTCATGGGGTTATTGTCAGCATTATGTGGAGGCATACTTGCTACAGCCTACAACAAATAGGCCACCATAGGCAAGGCGGCAGGGATCGATACCCAGTGGTGGAAGCGACCTCATTGGTCAGACAACGGACTGTTTATCCAGAGCTGTGTTAGCGTGTGCAGTCTCCGGGGTTTGTACCCGTGCCGGGAAAGCGATGGCTGAAAACCTGGACAGGCTGGTTGTCAGCCTGGAGAAGAGCTTGGCATCGTCAGACATGGACTGAGAAGACGTATGCGTTGGCGTCAACTTGGGCCATTTCCCAACAAATCGGGTTCATTGTAGGATCCTGTCAATTTAGATTGCTACTGGGCAAGGCCTGAAGCCCTTGTTCTCGCACATGGCCACCTTCGCCGTCAACGTCACCCTCACCCTCACCGTCGCAACCCAACCCAACGCAAACAGAGTCTAACAGGTCGACCTGTGAACACCAGTTTCCATCCTGCCCGTCCTGCCGGTGGCCTGGTGTTTCTTGTGTCGATCGTCCCTCTCCTTCTTGGCCTGGGCTCTCCCCTCTTTGCTAACATCGGCCTTGGTACAAGGCCCCTTGTGTCTGCTCCCTTGCAAGACGTTGAGGTCGAGCTCGTCCTCGTCCATCAGCTTCTGCGTCACCTCGCAAATGTCGGACAGGAGCCTGTCGAGCAGATCCAGCGACATGCTCTCGCGGACCACGACCCTCAAGATCTCCGTCTTCTCCTCGTTGGGCGGCAGCGCGTAGTTTGGTATGATCCACTGGCGTGCGCGGAGCAGCACCGACACCGTCTCCTGCTTGACGTGTGGGAACTGGCGCCGGAACTCGTCCGAGAAGCAAAACGCCACCACGGGCAGGCCGGCCACGTAGTCGGCAGACGTCTCCTTTGCATGCTCGGGCGTCACTTCGGGCTCCTTCTGCTTGCCGTTGCTGCCGTTGGAGCCGGCCGTCTCGACGCGGCGGTGGATGTCGGATACGCAGGTATACCACCCCGTCGCCTCGAGAGATTTGGACAGCAGCCTCGCGTTGGCCAGGCAGTTCTCCATGATGGCCCGGTAGCCCGAGAAGCCCAGATGGACGAGGTTAAAGTACTGCGTGATGACCTGGGCGCCGGGCCGCGAGAAGTTTAGCGTGTACGACTCCTCGGTGCCGCCTAGGTAGTGCAGCTCGAAGATGAGGTGCTTGGGCAGGAAGGACTCGTCGCGCCAGACGATCCAGCCAACGCCGGCCGTCACAAGGCCGTACTTGTGGCCCGAGGTGTTGATGGATTTTACTCTGGGGAGTGAGAAATCCCTGTGTTTTGTTGGTTTTTGTCAGCTCTCAATCACGCCTTGAAGACTTTTTTTTTTCTTCTTTTGGACACTAAAAACTTACCACTTGGGTCCACCAGCTTGTGCATGAGTAAAGGGGGCAATAAAAGCACCGCTTGCACCATCAACGTGGATTGGGATATCATGCCCAGTCTCAGCCTGGTACCTAAACCCAGGAGTACGACCATGTCAGTATCTTCTGCATCTACCAACTGAAGAGTCCAACATCCCAATGTGACACTCACTTGTCCAAGATTTCGGAAATCTCCTCTATGGGCTCATAATGCCCCGTATAGGTGCTGCCCAGGATGATGAAAATCCCTATGGTGTTCTCGTCAATGTTGTCGCGCACCATGTCGGCATCGAGCCGATACCTGCTCTTTTCCGACACGGGCAGGATGCGCGCCTCGACGTCAAAGTACCGGGCAAACTTCTCGAGGGCGACCTGCGCGTTGGCGCCCATGATGATGTTGGGCTTGCTGTCGTCCTTGCCGGCGGCCCTCCGCGCCTCCTGCCACCTGCGCTTCATGGCGAGACCGCCGAGCTGGATGGCTTCCGAGGAGCCTGTGGTTGCGCTGCCAATCTATTTTTCAGGTGGTGGTTTTTCCTCCTTTCGTGATTAGATTTTCGCTGACGACGACTGGCAATGTACCGAGTGGGGGAATTGGTTGGCTGAGTGGCACGGCACATACCGCTTTCTCTCCTTTCTGGACGTTCCAGAGGTGGGCCAGGATGCTCACGCAGCGCTGCTGCATCGAAATCATGGCTGGGTACTCATCCGCATCGGAGAGGTTCTTGGCAATGTTCTCTACCATGAGCTTCTGGGCATTGTCTTCGAGGTAGGTGCCCACGAAGCTATTTTACAAAGAGGTTTGGGACAATTCAAAAGTCAGCTCGAGGTCAAAATTTCACTTGCAGCAGCTAGCTGGCTGCATGAGCCGGTTGCCAGCTCGGTCGGAATTTACCTGGCCAAGTTCAGATTCGGCTTCCCGTCCAGGTCAAGCTCATCGCGAATCATCGAGTAGACCGTGTCGGCCTCGGCGCCCTCCTTGGGGAGCTTGTACTTGGGCAGGCTCACGTTGCTCGCGTAGCGAGACGAGTACGGCGTCAGGTGGGAAATCGCAGCCTGGGTCCGCGTGTCATTGTCGCCGTCCTGCTCCTTCAAAGACGAGTTGTGCAGGTGCTGGACAATGTCGTCCGGGTTTACCTGAAAGCCGGTTTGGGTTAGTGGGTTGCTCTCTTGTTCTTCTATTCAGGAATGCCAACAAAAAGAAAACCCCCCGACTGATGCTTACATGGCGTGAGAGGACCATGTTTGATTATTGTTCTCTTGACGATAATTGATACAGGTGGCAGGAATTGCAGTCCTTGGAACGAATGGGTTGGGGGAGAAGAGAATCCCCAGATGCCAATCACAGCAGAACGCCCACCTTTAAGGCAAGTCTGTCTGACTAAAAACAATGTCGGAAGCTAGGCTCGACAACGCGTGAATTAGCCGTATGGGGTCAGCATCCGACTGCCACCAAAGCCCCTGCGATTAAAAGAAAAAGAAAAAGGGGAAAAAAAAGAAAAGAAAACACAATCTTGGGGTAAAAATATGTGAACAGTTCAATACTCAAACCGGTAGACCAACAGCAAACCCACCGCCTGCGAGAGGAGAAACAGGGACCGCAATGTTGGAAACATTCTTGCAGTATGTCAGGTTGAAGCCTTGGCTATCAATGTTTCCAAGCGTCGGGTCGTCGTCCATGAGCTTCTGGACATGGGTATGATTGGTCAACCTCCATATCGAGTTTCGAGAGAGATCAACATGGACGTGGCTGTCACTGTGTTCCGCCACGGCCGACCCGACCCATTCAGACATTTCCTTCAGCTGCAAGTCAATGCCGCCCCTGCCGCTGACCACAATGTCACCTCTAAGGGAGGATTGTGCAACACTGAATATCATAGCTGTACTCTCGTCTCCAAAGTGCCTCTTTTCGAATCCGCTCGAGCCATCCCAGGCAGGCATGCCGGCGGCGACAGCTCGGACTAGAGTACCATTGGCTATGATTGTGCTCCGCGCCATATCCACCCTCCCTCCGGTGTTGCTGAGCCACATGCCCACCGCTTCGGGCTGTATAGCTTTTATAACCGTGTCGTTCACCCTCAACCAGGGTGTAGGTCGCGCGTTCGGACGGCTTGTATTGTCAAACATGACGATGGCCGCAAGCCCGCCTGCCTCGGCCTCAACTTGATCCAGACTGATTACTAGACGGTCCTGCCAAACAGCCTTTGTACTGTCGACTACAAGAAATGGGCTCCGAAACGAGACGCATTTGAATTGCCGGACATTCAAAGAACCACCTAGACTGAATAGGCATGGGCTCCCGGGCCCGAAGGTGAGCCCTTGTGAGTTTTCTATCCGGACGCGGGAGTACAAGGTCGATGCAGCCGCGATGCTGCTCCGAGGGCCTGTCGTTATGGCCGATATGCCGCTCATGTTGATGAAGCCGCCACCTGCAGCAAAGACCGAGTGTCCGACTGGGCTGCTGCTAGACAGCTTGGCGCCGTTCAAGGCAACCGAGGCACCATGGACGAAGAGGCCAATGGAGCCATCGTTGGCTTGGACGTTGACATTTCTCAGTATAGCGCTTGCCCCGTTGGCCTTTTTCGATGATTGATCGATTATATGTCAGTGAGCTTCAATCATACCAGCATTTGGCGAGATGGCTCAGGCTACTGACGACATTCACCGCAGCATTGGACCCCTAGGTCTCGGCAGCCAACATGTCGGAGCTTCTGCCCGATTTGACCACCTCCAAACCATCCGCCTCCCAATGCGTGCCACTGGGGACTAATACGGTGACCATGTCATCTGCATCTACCGTAAAGTGGCCTTGTCGAGTGATGGAACTCTCTGGCGTGATAATCCATGCCGACTTGACTGGTCCTTGCTGAGTGAAGTCGCTGGCGTTACGCGTTTCTTGCCACAGGCCGTCTGCTATGGTTTCTGCTGATGCCAAAGCGACATGGCAGACAAGGACTTTAATGGCAAGCAGGAGCAGAAGCATGTTAGCGAGCGGGCTCAATGTAAACCAGACAAACGGGTCAAAGTAAAATGTTATAATGTTGGGGATACTAAATGTTCCGATATGAATGCCGCAAGGGATGCGAAGTTGGACTGGGCTGGGCTACGAGATTTGAGGCTTTCGGAGGGTTTCTGCAGAGTGTTGGCAGCATCAAAACTGGAGTGAGTCGAGCGAGATATCTGCGTTCTTTTAGGTAGGTACCTACCTACCTTAGGTAGGTAAGGCAGGTAGGTAGGTAAGGTATGTACGTCAGCCTACCGCGCGAGTTGAAGAGCAGGTGCCGCCCATATATTCGACTTTGGCACCTTCCTCAGCCAAGTGTGAAATCCATCAGGTCGCTACATCCATCCAATCCCAGCCCGGAGCGTAGCAACCAGGAATAACCTACCCATTGTTCCCGCCACATTTAATGTCAAATGCCCGCCCAATATGGTAAGCCGGATATTTCGCATAGGCTAGGTAAGGTACTGTACTGTACGTATCGTAGGACTAATAATTTATTGAGCGTGACAGTTATATTCTTCAGCAACCAAATCTACCTAGCCAATCAGAGCACTACTTCCAGAACTACCTAGTTCTGGTCAAGCTGCCCGAGCGCCCTAGCGTTAAGCCTTGCGGCAGCCAACCTCGAAGCCTGCTTGGCCGTCCTCCCGGTCTGCTTGCCGGCTCCCGTAGCACCACCCGCAGCAGCACCCGCGGCGGCAGCGCCTCGGCCGCGTCCAAAGGGATTCTCGTTGCCCACGACTCCCTTCAATACGGTCGCCACGTTGATGCCCTTGACGGCGCCGTCGCCGCCCTGCATGATGTTTTTGTAGTTGTCGGCAACCAGCTGGATGCCCGAGACGAAGTCCTTGCCGTCAAAGGCGCAGTGCCCGCCGTTGGGCGTCGCGTCCACCGTCTGCAACGCGTTGATCTGGTCTGTGCTGAGACCAGCGTCCGAGGCGAGCTTCTCGTACGCCTGGATGGCCTGCGGGATGCTCTGCTGCAGGCTCGAGAGCTCCCGCTGGCTGCTCTGGAAGTGGATCTTTGTGGTTGAGAGGGTGGCGGCCGCGTCCTTGAAATCGACCGCCGGGGGCAGCGCTCCGCAGTCGAGGAGCACGCCGTTGCCCTTGAAGTTGGTCAGGTGCGCGGGCATGAAGAAGCCCGACAGCGTCAGGGAGCCTCCGGAAACACCGGTGAAGAAGACGTTGGACTTGTTGAACGCCACCATTTGGGGGAGGACATCCAGGATCAAGTCATTGACCGCCTGTGCGTCTGCAACGCCATCGGGACGATCGTTACCAGCCGGCTGGCCCTGACGGTTACCCCAGAGAAGATTAACTAAATAAAACACGAGGTGGGAAGGTACCATGGGTTAGTGTGTTGCCTGACTTAAAAAAAAAAAATAGAACAGAAGAACAAAGACTCACCCGACGGCGCAAGCACAACAACACCCATAAGGTTACCCTGAACGGCCTGGTTCGGGAAATCAAGGAAAGACTGTCCACCGTCTCCATGAAGCAGCACATTCAGTCCCAAGTTACCCTCGGCGCCGGCCTGTTGAGCGCCGCCCTGAACCCCCGAGGCTGCTGTAAACTGGTCTGCAGGACCGCTGATCTTGAACCTCAAATCAGCGCCGTTGACCTTGGCCGTCATGTCGAGGATCGTGGACCCATCGGTAGCCTTGCTGACACCCTGGGGAACCTGGGCAAATTGCTGCTGAGGAGTCTGTCTCCGCCCACCCTTCCTCTGCGCCTCGACGCCGCCGCTGAGGACGCCGAGGAGCAGAAAAACAACAAGATTGAAAAACGAGCGAACGGTCAACATTCTGGCTCGTGGGGAGAAGCGAAATTAAAGAAGAAGAAAAAAAGAGGCAAAAAAAGGTGAAATACAAAACAGAAATAAAGCAAAGAAGCGGATGAAGAAAGGAAGAAAAGAAGAAGAAAAAAAAAGAAAAGAGGCCAAGCTCAGAAGCCAATAAGGGACAAGGCGAGTAAGTGGGAACTACCAGTTCTAGATGCGGCACCCAAATATCTAAAAAGCCGTTGTCTGTCAAGTCTGAGACATGACGGGTCTTCCCTTGCATTTGCAACCATCAGACAACCCTGTCCGGCGAAGAACCGGGGGTAAACTGAAAAGTTGGGGAAGCAGGACGAATTACTACTTGGGGCGATGCCAAGAGGCTACTGCGTACACTGTAGTAGCCAACGTGTGCCAATGTGAGACACTCGGTTGCCCTATCACTCAGCACCAACCCAGAAAAAAAACATGGGATGGATGCTGTGCCTGTAAAGCCCTTGCAGCGACCGGGCACAAAGTGCTACTGATACATACAGCTAAGTTGAGACTGGAACCTAATTTGTCCGGCCGCATTCTCATCTCATGTAGAGCATGGTTTGCAATCAAGTCAGATCGGGGAAAGAGTGCTCTGGTGCAACAAGCTGGGTTTGTAAGATGAGCGTTTGTGTGACACTCGGCAGAAGTCTGTTTTAACCATAAAGAGGTGCGTGTTTTAGCCAAAACCCCATGTGCTGTAGGGGGGGTTCGCGACTCTGTGGTTTTGGGTTGGTGGAACCTTGGACCCTGTCCGTCTCCCTTTGTGATTTTACCAAGGTGAAAGCTGCAAGTCAATGACCAACAACCGCGCGGCTTTTTTTTTTTTTTTTTTTTTTTCAAAGGTCTCAATCGACAGCTTGAACCGTGTAATTTACTGGTTTTAGCACGACTAATTATGAGTGTCAGTCAAAAAGCAAATCTTTGCCGAGACACACAATGGTAGCAATAGCGGATGGGGGATAAACTCGAGAGGTGTTCCAGAAAATGACCCTCTCGAGCACAAGCGATGCCCATACTTTTTAATTTTCCCCCCAGAGCACAAAGCGCACGCGCGCGCGAGATGCATGCTTGCCCAGATTCCAGAACCTCGGCGGAAACAATGTTGCATCAGTTCCCGTTCTCAAACGTGGTAGTGGACCGGGAACAGAGTGGAGTGGCGGAAAATACTTGATACAAAAATAACTCTGGCAGTTCCGATTGAAAGGACGGAAACATATTTTACTATTAAGCGTTAACCCGAGAAACAAGTCGATAAAGCATTAGTCTTTAGTGCACACGGTTACGATGGGACCGTTAAACACTTACCTGAGAAGAAGAAGAAGAAAAGTCAAAATTTGGACGAAATCGAAATCGGTTGCGTGACCCTCGAGGAGCGAGACTACCAGATCTTGTATGTACAAACGAGGAATCGACACAAGCAAGTGTCCTACAACTTGGAGCCCTGACTCCGCCTCTTCTCCTTTTCCCTGTCCCGCAGCAGCCTCCTCAGGATCTTGCCCGACGGGCTCTTTGGGATCTCGGCGACGAACTCGACGCCTCCACGCAGCCACTTGTACGAGGCCTTGTGCTCCTCGACGTGCTTCTCAATCTCCCTGGCCAGGTCATTGTCCGACTTGCCCTTGCTGTAGGCGGCGTTCTTGACCACAAATGCCTTGGGGACTTCGCCCGAGTGGTCGTCGGGTATCTGGATGACGCTGCAGTCCTCGACGGCTGGGTGGTCGAGGAGGTGTGCTTCCAGCTCGGCGGGTGCGACTTGGTGTCTCTGTTTGCAACATTTCAGCAAAAAGAAAATAAAAAAGAAAAAGAAAATAGTCAATGTGAGCCCCGTGATCAACTCCAGACTTACCTTGACCTTGATCAATTCCTTTATCCGGTCCAGGATGACCAGGTGCTCATTACCACCCGGCGACAGCGTAAAGAGCACCTCGTCGCCCGTCCGGATCCAGCGACCGTCCTCGTCCCACACAAACGTCTCGTGCGTCGCCTTCTCGTTGTTGAGATAGCCGAGCGTGACGGATGGCGACTGGACCCAGAGCTCACCAGGCGTGTCGAGCTGCGTGACCTCGTTGCCGTTGGGATCCATGACCTTGGCCTTGACCCCCGGCAGAAGCGAGCCCGACGACCGCGTGTAGATGTCGTCTTCGCTGGTGCCGGACACCACCGTTGCCGTCTCCGTCATGCCGTAGCCCTGCACGACGACCCAGTCGGGGTAGATCTTGTTGAGGTTCCCGACCGTCTCCTCGCCCAGGGGGGCCGCGCCGCTGAAGACGCTGTGCACGCTGCTCAGATCGTATTGCTTTAGCTTGTCGTGGTTCTTGACCATCTGGATGATGATTGGCGGGACCTTTTTTTTTGGTAGTTACTTTTGCGTTAGCGGTTGAACATGTCAAAAAGGAAAAGAAAAGAAAGTCTATCTTTTCCAACGTCTTTCTCTCAAATCCCCGCCCAACATACCAGATAAAGCATTGAAATCTTGAACTTTTGGATCGCCCCGAGAAAGGTGGCCAGCTCAAACTTGGGCAGGGTGATGATCTCATCGCCCCTCCAGGTGCCGGCGTGGTTGATGACGACCAGGGCGTAGATGTGGCTAAACGGCAGGAGCCCCAAGATGGCCTGCGTGGTGACGCCCCTCTTGGCGAGGCTGGGCCCGTCAAAGACGTTGTACTGGAGCACGTTGGCGATGACGTTGCGGTGCGAGATCATGACGGCCTTGGGCAGGCCCGACGTGCCGCTCGAGTAGCAGAGGAAAGCCGTCTGGCGTGCGCCGGTGCCCCTTGCCCACCTGAGCCGCTCCAGCTGCGGCAGGCTGCTGCCCTCCCGGATGAGGTCGTCGACCGAGACCACGGGCGTCGAGGGTGCGGGCCCGGGCATCCACATGACAAAGATCTTGTCCCGGGCTATGCCGGCCTCCTTGGCGGCGGCCAGCGCCGTGTCGAGGAGCAGCGCGCACGTCACGAGGGCCGAGGCCCCCGACGACTTGAGCTGGTGCGCCAGCTCCGGGACCGAGTACACGGCGTTGGCCGGCGTCACGATGCCGTTTAGCCTGTGCACCGCGTAGGCGACGGTTTGATAATCAATCTAATACATGTATTCCGGGGGGCGTAAGCGCAAGCTTTCTTGTGGGGAAGAGGCAGAAACTTTGTCCTTCACTGACCGTGTTTGCCGAGAATATCCCAACCACCTTTTCCCAGGGTGTGTCCTGGTTGGGAGACCAGCCCATCCTCTTGCCCAGAGCTCTCGAGAGAAAGTCGGTCCGCTGTTGGACCTGTAAGATGCTGTACGTCTTGCCGGTCAAGCCACAGGTGAAGGGATTCCTGCTCTCGGCCAAAGGTCGACGGCCGCATGTTTCATTTTTAATGAACTCCTCAATGGTCATGGAGTCCGGGGGGTCTTTTGTTTTCTCTGGTCAGCTCGTCATCGCTCTGGGGTACTCATCAAATCCTGCGAAGCCGTCGCCGACCTAGATCCAAAACTCACCGAACGGCAGTTTCGGAATGTACTCCGGCGGAAAAAAGACCATATTTGCTGGTTTACAGATATGTATACGTAGGTAGGTAAATGTCTAGATACGTTTGATGTACAGTTCAGACACTGGCAGGGAACAAGCTTGAAAGAATAAATAAAGTAATTAATCAATGCAAGCCCAGGTGGAAGAGGGAAAAAAGGGAAAGGGAACCAAACACAGCCCGCACGGCCTCTCGCACAAAAAAAGCCTACTGCTGGGACACGACTCTTTTTTGTGTGTCCTTCCTTCCCCAACCAGCATAGCCGGCACAACAGTGAGGAGAAGCAGTTCGACAAAGCCGAGCCGAGTGGGTCTCTCCCCCAGGTTTACCACTTGAAACCCCGCATACCAAGAGTTGGAGGGTATGACAGAAAGTGGACAATTCGGGGCTGTCTATGGGGAACATTGCCGCCTTTTCTTTCTTGGCCACGAGCGCATTGGAAAAGATGATGACTGAATAAATTAGCCGCATTCCGTTTCTGCCACGGGCTTACAGAGTGTATTAGGTACCTATTAAATAAACCCACATGATTTCCATGACGATAAATCTTAGCAGAGTCCTTTTCTCTGGTGCATTGCACATCAACTCTTTTACCATGCACGCAATACAGAACAGTCCAGACAACAAAGCATTTCTTTCAGCTCATTCTCGATTCAACACATCATGTGGGTAAATCTTTCATATATCACAAAATACAATCCCAAGTCCTGAGATTCTTTTTCCTCCCCAGCTAGGAAAACACTTTGATAAAATTACAATTTCGAAGCGGGCCTGGCGCTTCCGGGTGTCGTGATCTCGTTATACAAAAGCCTGTCATGACATGTTAGCATCTTGAAAGATTTGTGGGGAAAATAGCAAAAAAACCTGAAGAAAGAAAAGAAAAGAGTATACTCACGTTGTCAAAAAGTCGGCATAATCCTCGCCGGTAACCTGGGTGGCAAAGTACTGCGAGGCCAGCTGCATCTTGTTGCCGGCGGGCAATGACTTGGCCATCTTGTCTGCCTCCTCCCGCAAGAGACGGAGCGCATACGACTTGTCAACCTTTTTGCCCTCTGCGGTGCTCACGCCGTGCTTGACCCACTGCCACAGCTGGCTGCGGGAGACTTCGGCAGTCGCGGCGTCCTCCCTATTTATTGATCCTTGTGTGAGTAGATGTGTCTGGCACAAAAACATTTACCCGGTTTACCTCGGCAGCTCAGAAGATTGGGGGGCCGAAACGACAAAAACAAAAAAAAAAAAAGAACAAAAAAACTCACATCAGGTAGTTGATGGGCACGCAGCCAACGCCGCGGATCCAGGCCTCCATGTAACCGAGACCAATGTACAGGTTTTTCCTGATTCCATCCTCGGTGATCTTGCCCGGTACATTCATGTTGAGCAGATCCATGGCCGTAATGTGCACGTCCTCGCGCCTCACAAACAGCTGGTTGGGCGTCGGCATGTGCTTGTTGAAGATGTCTGAAGCGATGGCCGCCAGGGCCGGGTGGGCAACCCAGGTACCGTCGTGGCCCGCCCGCACCTCGCGCAGCTTGTCGGCCCGGACACCATCCATGGCGCGGTCGTTGGCCTCCTTGTCGTCCTTGATGGGGATCTGGGCAGCCATGCCTCCCATGGCGTGCACGCCGCGCTTGTGGCAAGTCTGAATCAGCAGCTTGACGTAGGCGTCCATGAAGGGCACCGTCATGGTGACAGCCGAGCGGTCGGGCAGCACAAAGTTGGGGTGCTGGCGGAACTTCTTGATGGTGCTGAAAATATAGTCCCATCGGCCGCAGTTGAGGCCGGAGCTGTGGTCGCGCAGCTCGTAGATGATCTCGTCCATCTCGAACGCAGCCAGGATCGTCTCGATGAGCACCGTACCGCGGATCGTGCCACGGGGCATACCAATGTAGTCCTGGCCTAGGTTGAAAGCATCGTTCCACAGCCGAGCCTCCAGGTGCGACTCCATCTTGGGCAGGTAAAAGTATGGACCGAACCCGCGCTTGACTGCCTCATGTGCGCTATGGAAAAAGTAAAGACCAAAGTCGAAAAGCGATCCACTGATGGGCTCTCCGTCGATGGTCACATGCTTCTCCTCGAGGTGCCATCCACGAGGCCGCACAATGAGCGTTGGTAGAGTCCTGTCAGTCCGCAGCTTGTATTCCTTGCTGCCCTGCTTGAAGTCCACCTGCCGACGAACGGCGTCGTACAGGTTAACTTGCCCGTTGATCATGTTTTCCCATGTGGGAGCGCTGGAGTCTGCTCCGTGGCATTGACAACACAAGGTTAGACAAGGGCCTATTTATGCCTGCTATCTTACTTGGAACCGAGGTACTCACCCTCAAAGTCGGCCATGTACGTCCACACATTTGAGTTGAGCGCGTTGACAACCATCTTCCGGTCCGTAGGGCCCGTGATCTCGACTCGGCGATCAACCAGGCCCGGCGCCGGCGCAGCTCCCTTCCAGGTCGAGTTCTCTCGGATATGCCTGGTCTCGGGCAGGAAGTCTGGAAGAACGCCCTTGTCAATCTCGGCCTGGCGCAGCTTTCTGCGCTCCAGCAGCTGCTTGCGGCGCTCGTTGAAGGAGCGGTGAAGCAGGGCGAGAAAAGCCAGAGCAGGTGGTGTCAGAATCTTGCGCTGAGACTCATTGACCGTGCCCAGGACGTTGACGCCCTGGAGTATGGACTCTGTGGAAGCCATGGTGGGCGCTGTGTGCTGTTGTTGTCTTGTAAGGTGGTGAGGATGCCAAGTAGCAGGCCTGTTCTGTTTGCAATGTGTGGAGAATTCCCGAGACTACTACTACGGAAGCTCCAACCTGTGGTAATAAAAAAAAGGGTGTTTACTTTTCGGTAAAATGACGGCAGTTACAG
GTACAAAACACTAAATCGGACTTACGACTGACGTTACACACCTTTGACCGACAAAGGTCTTGGCCCCAACTTGACTCCCGCTCTTCTCCTCCAGTTCGTC
AAGGATGAGGGCAACGTTATGTTGGCTCTTTCTGCCGAAACCGCCGTGCCCATCTCGATCGTTTCGCTTCTCCACGAGCTCGATATCCAGCTCCCTGCCG
ATCGCACCGGTCTTGTGGTCGACCATTTCCACTATGACAAGATCTCTGCCGCTGAGAAGCACGATGTCATCCTTGTCAAACCCAGGCCGGTTCGTGACTT
CCACAAGGACATCTTTGGCAGCGAGAAGCAGACCAGCCAGCTGCTTGCGGTTCCGCGAGCCATTGGCCAGACCCTTGGCCAGAGCCCCCTCCTGAACCCT
GTCCTTCGCGCCCCTCTCACCGCCTACAGCTACGATCCTAAGGAGCAATCGGAGGTCGTTGATGACCTTTTTGCTGCCGGCGAGCAGTTGAGCCTCGTCA
GCGCTGTGCAGCCGCGTAACTCGGCTCGCGTTACAGTCGTTGGCTCTGCCGAGATGCTGCAGGACCAGTGGTTTGATGCCGAAGTCAAGCCGTCCAGCTC
AAACAAAAAGGTCTCGACCTACAACCGCGAGTTTGCCAAGAAGTTGAGCGGCTGGACCTTCCAGGAGTACGGTGTCCTGCGCGTCAACTCTGTGGAGCAC
CACCTGAACGAAGCGGGCGCAAGCAACGTTTCGAACCCGGCTATCTACCGGGTCAAGAACGATGTGGTAAGCTAGCAGCGGATGCTGTTGTTTTTACGTG
TTAGTCTTTGTGATTTTTTGCATACTGATCAGGCTGGACCGTAGACCTACACCATCTCTCTGTCAGAGTACAAGCCCGAAACTCAGTCCTGGGGACCATT
TACCGTTCCGGATGGCGATGAGATTCAGCTGGAGTTTTCCATGCTGTCGCCCTTCCACCGCTTGGGCCTCAAACCTACGACCTCCACCGAAAGTGATGCT
ACCAAGTACAGCGTGTCTTTTACGCTGCCCGACCAGCACGGCATCTTCAACTTCCGTGTCAACTACAAGAGGCCATTCCTCACCTACATCGACAGCAAGG
ACCAGGTCTCGGTCCGCCACATGGCCCACGACGAGTGGCCACGCTCGTTTGTCATCTCAGGCGCATGGCCCTGGATCACTGGTATCGGCGCCACCATCAC
TGGATTTTTGGCCTTTTGCCTGGTTTTCATGTTCAGCGCACCCACTGGAAAAGCCACCGTTACCAAAAAGACTCAATAAATTGGGAATTTTGGAGAGGCT
TTACTACAAGTGCCAGAGAAGCCTGAAGCTTTGGACGTTGAACCTCTTAAAGCGATCAAGGCTCCAGGGCAGGTCACGTCGTGCCGGTGCTTAGTGGCGT
TTGTCTGTCACTAGTATCCGCTACTGGAGCATATTGCAGAAATTTGGATGGCTCACTGGAAAGGCTGAGGAAGTTCGATTGATGACTGATGAGCTGAACA
GTCTTTATTTACATTTTGAGCCAGCTGTATGTATAATTCGGAAAATGGGTACCATAGGAAATAGGCCATTTGGTCATGGCCGGTTATGAGACAATTATGC
AAGTGTCTCTTAGATTTTTCACTTTAAACATTGCAGTTTGAAAGTACTCCGTTGATGCGAAATCAAAGAAAACTTTTGCCGTGGTAATGATGTGACTTGT
GACTGTTTACAAAGTAAGGGATGAAAAGTGTGTTTGAAAATTGAATGACTTGATGTTTCTTTGAATACTTTATATTTCAGGTTATTGAACGTCGCTGTAC
AGATCCCAATCCTGCCCAATGTCATGGCTGAAACGAACCACTCCATATCATAGGACCAAGAGTAGGAATTTGATATTCATTTTTGTACCTTCAATGTCCA
CTCAGATAGAGAGAAAAAAAAAAAAAAAAAAAAAGATGCAAATAGCAACTGTACCGGATATCTGGTTACCCAGTGCAGGAAAACTTGAAAGAGACGTAGC
TACTTACTGCAATATAAATTGTCAGCGTCTTCACAAGCTTTAATTGCAACACGACGGGAAAAATGAAAAGGAAAAGAAATTACAAAGGTGCCCTCAGATT
AGCTCTCTCAAGTTCTCATTGACCCAGCAGGCAAGAGCCGCCCAAAACCTCCCATTCCATACCGGGCCGCGCCTCGCAAAGGGACCAGCAGCAGGAATCA
GTGGTTGGGCAGAACTCGAGCCCTTGAAGATGCTGAAGGTCTGCAAATTTGGCTTTTTGGACACAATGTCATCACCGGGCCTTTGTGTGATTTCTTGACA
AAATGAAAAGAAAACGGGGGGAAATGAGGACCTTGACCGATTTCACCCCCTTCCATCCTCAAAAAATAACAACAAAACAAAAACAAAAATGAACGGCATC
TGATTGAAAACTACAATATTTCTTTGGGTCATCGGTTCACCTCCCTCATGAACCACAATTAGGGCCCGCATTCCTGCTGAGAACAAGGTTCCCAGAGTAG
CTTGGGGGCATGGGTTGGCTGAGAGAGGCTTTGGGAACCTCGAGAAAAGCAGATTGTCGTCATGGCCGCTGTGTCTTTTCGGCTTTGCCATGTCGTGTAA
AGTGGGATAGATAAAGGGGGTGGAATCGGGGGGAAAGGCTCCTCGCTGCTCAGATCTCTGTTCTTGTTAGGGGCTCGCATCGGCCATGGGGAAACGCAGA
TGCCCAATAAAAGGCTGATCGGTTTGCATCCCATGCCTAAAGACTAGCATCTACGTGATGGGTTTGTCGTCATCGCAGGGGCGAGGATTGTCCCAGATGC
TGGCAGTTGGGGTGTGATGAAGGAAGACAGAGAATGGTGAGATGGCCGTTGCTTGAACAGCTAGGTAGCTTCCTGCCTGACTGAGGCTGGAGCTTGGAGA
GCAAGTAGCCGTGAATGATATGAGAAGGATTGAGCTTACCCTTTTGTCACGTTGTCGCCCAAAGATAGTCAAGTATATGAGATTGCCCTTTTCTGAAGAC
TGTTATTTACCTGCCTGTTTTACCTGGGTTTCAGAACTGGGTCCCCGACCAGAGAGAACTTTTGAGGGTACAAAACATCTTTGAAGGTGGACGAACGGTT
GAATGATTGAATTTCCAGCGCGACGATGAACGCGTCCTGCAGGCTCATGGCCCACTCGCCCAACCCACAGTAGGTGAAGGCCCCCACTAAAGAAGTTCAC
AAATCCCCGCATTTATTTCTTATCGATATCTCATACCGACATGGTTCTGTCGTCGGTGAAGACAATCCAACGGTAATGACCCGCGTCTTTCGCCGATTGT
GAATCCCGCCCCCAAAAAAAGACCCGTTCCGACAAAGTTGCCAGTCCGCTGGTGTCGTGCTTTGCTCAACCTTCAAATCTAGCCGCCCCGAGGCCTATTC
TGTATCTGTCCACGACAGTCTTTAGCATACAAGGTCTCGGTCGCACAGGCGACAACCCGCCGGCAAGATGGTAAGGCACCTCTCCCTCCCCCCCGGATAA
TGCTCCGTGTCCCCAACGTTGCTAACCCCGTTCATTTTCCCCGTTCCACCAGGCGCGCAACTCAGAAAAGGCGCAGTCGATGCTCTTCCGCTTCCGCGAG
GCGCAGGCGGCGGACCTGGGCATCATCGACGCGGGGCGCACGCGGCGGCCGCGCGCCATCACGGAGCAGGACTCGATCCCGGCGTGCGAAAAGTGGCGCG
GGCAGGTGCTCAAGGACATATCGCGCAAGGTGTCGCGCATCCAGGAGTCGTCGCTGTCCGACTACCAGATCCGCGACCTCAACGACGAGATCAACAAGCT
CATGCGCGAGAAGCACATGTGGGAGGTGCAGATTCGGAACCTCGGCGGGCCCAACTACACGCGCGCCGGCGGCGCCAAGGTCTACGACGAGGCGGGCAAG
GAGATTGGCGGCGCCGGCAGGGGCTACAGGTACTTTGGGCGGGCCAAGGAGCTGCCGGGCGTCAAGGAGCTGTTCGAGGCCGCCAGGGCCAAGAAGGGCG
ACGAGAAGCCCCTCGAGGCCAGGGACGACTTGAGGAAACAGGTCGATGCCGCGTACTACGGCTACAGCCCGGACGAGGAGGACGATGAGCTGCTGGCGTA
TGAGGCCGCCAAGGAGAAGGAGGCCTTTGAGAACCTCGCCGACAACAGGAAGGGAGAGCAGCTTCCTCCCGGTTGGGAGCCTCTGCCGGGCGATAATGGA
GACGGGAAGGGTTGGGAATTGCCAACGGTTGAGGAGGTGCAGCAGGAGCTAATAAATCGGAGGAAACAGAGGCTGCTTAATCAGTTATAGTTGGCTGATG
CCATCTCGGAGCTGTGCCTGTGTAATGTGGGGGGGGGGGGGGGCGTTTGGCGTCTAGGGGCTGCATTTGGCTTTAATTCTATTTCAACTTGAACACCAAC
GAAATCTTTTCTGTCTTGGTTGTGTGGATTGCGTAAATGTATATATCACACTAAGCTGGGGTTAATCTACCTCGTTTGACATTATATGAGAAGAAACAAA
AGAAATACCGGATATATAAAGTGTGCCAGTCCCCAACGCCTAATAACCACAATAAAATCAATAAACAATCTTCATTCTTGTACAAATGAGCTGTTCAGCA
GTCTCCCTTCCAGTTCTCCTGGATCCAGTCGGCCATCATCTCGGTAAAGGTTCCGTTCCGATAGACACCAACGTCATCCGAGGTATAGTCGCCTCCCGCA
AACTTGAGGGCGAGCAAAACCCACGGCTGGATGAAGCTGATGAAGACAACGTCCACCTTTTCAGGGTTCTTCTTCTTTCCGTCATCATCGACGGGAAAGC
CAACCTCGGCCTGGACACAGTTCGGTACTCTATAGAATGACAATGGCGAATGCACCGCATCGTCGCCATCATCAGATATGTCGTCCTTGGTTGTGTAGCC
ACCAATCAAGGCCGGTTTGTGTTTATCATGATGGCTCAAAGGCTTCTGGTCGAAATCCTCAGCGGTGAATGAATGAGACGGGGTCGATGTCGAGTCGGTG
ACGACGACGTCCTCGGTACGGAACCACTGCTCTGGTGAGGCCATGAATCGCAGGTCTGGCACACCTTGTCCGGCCGCAAGAATCGGTCCGCCGTTGTTGA
GCAGCTTAATGAGCTTTTGGGCAACCTCATATGGTACATCCTTGACGTAGTTCAGTCCCGAGGTGAAAGGGCTGACAATAAAAGTCGAGTCCCTGGTAAA
CGGGCCCTTGAAGATGTCGAACCTTATCCCACCGGTGTTCAAGATAGCCAGCCGGGAATTGTTCTTCCTCTCTTCATTGACGGCGACTTTTGGCAGCACT
TCCGTTTCCAGCCAGGTATAAACGCTCTCATTTCCAGGGTAAGGAGCGCGGTTCATCCAGTAGGTCTGAGGTGCACATCCGTACTTCTCATCCAGCTTGA
GCTCTTTTCTGGCGGCCGTAATCATTTCAGTCACTTCTTGGCCCTTCTTGGTAGGAAAGGTGGACTGGTTGAGTCCAGTGTGATGGTACAACCCCAACAG
GTTGTTGTCGATGTACCGCCTCTGGAATTTGACTGGCGTCTTGCCCTTGGTAGTGTCTTTGTAGAGCCCATCTACCGACATCCACCCTATAGTCTCAAAG
TACCGACCACTTGCGATAGCATAAGCGCCGTCGTCGAACTTGACGGCGTCTCTAACATGCGCATGTCCTCCAAAGAAAGCAATTGGAGTGAACCAGTTTT
GCTTCCGGATCTCTGTAAAGATGTGCTTAAACTCTTGCATCCGTAACCCGACGTGTCCAATTATGACAAAGATGTCAGGCTTCTCCTTGATCGCATTCTT
GAACCACTCTTCCTCGACAGTGTCCTCAACAGGTTGTACGACTGTGTTGTTGGCGTTACCGGTAAAGTCAAACAGAAAACCCATGGCTAGGACGTCCATC
TTTTGGTTCTTTGTTTTGAATCTACGAAACCGCTGAGCCATGGGTTTCTTCTCGCCCGTCTCTGGGTGTATGTAATCGAGGTTGGAGGCGATGTACTTGT
CCTTGAAGTTCGGGACAGTCTGCGACCATTCGCGGTCAGCGGCGTCGGCTTGGTAGAGCTCATGGTTGCCGGTGCAGATGATATCAATGTCCTGCCGACG
GAATATGTCGTAGGTGAAGCGGCCCTTGGGGTCCGAAGAGTCGTAAAGCCCGTTGCCCTCAATCCTGTCGCCCGTGTCGACCAGCAGCAAGTCGCGGCCT
TCCTGGTCGGCGCGGTGGCGGAGGTGCTCGGCAAAAGAAACATAGTCACCCCAGTCTGCCGAGTACTGGGACTCGAGGAGGTGACCACCGTGCCAGCCGT
GGGTGTCGGTCGTGTGCAGAAAGTTGAGCTGTGCCCACTGGAGGTCCCTCATCGGAGCTTCAACCGGTTTGGCTGCTCCAGGCTGGGACGCGCGCCCGAC
CGTGGCCAGCGCGGCCGTGACGCATCCGACTAGTGTTGTTCTAAAAGCCATTGTGTGTTGCTCTGATAAAATGATGAATGTAACGAGATGGATTTATGAC
GGCCAGTTCATTGTGGGGGTGCTACTAGGACGGCTGTAGATGCCAGAATAAACAATAACGGCAGCGTTGAAGGAAACTGCACGGATTACTGTGTGGCGTC
ATTCATTGTAGAATTAGGACGGTAGATAAAGCTCATGCAGCTCGAGTGCAGACGACGTGGGAACTTCAGGCAGGAACCCTGATGGCCTGGTGACGTTCCC
CTCGCGCCAAACATTGCCAAGGGCCAAGATTGCAAGGGTCCGTGGCCCGCTTGACCTGCAGTAGCTGCGGGGATCCGATCCGTCCTCGGATCAGAGCGTA
TTTGGAAAACTCGAGATTGATTCGATTCCCCTTGACTGCAATTCCATTATATATTTCAACACATCTCTATTCTGATCGTCATCGTAATGAATAAAACAAA
AGACTCAAAATAATGTCTTGTCTCGCTTCTTGAAGCATCAGCTTGTGCTAGGCAGCAACACACAACACAACAAACCGGATACCGTACCTTATCTACCACA
CCCACAACTCAAACGCGACAGAGTTTGCCATCCACTTCCTTCCAGCGCTCATTCCCCACACATGGATGACACCAAAAGACATCATCTGGATCAACATCTC
TCTTAATGGTCTTTAGCCGATCATAGTTTGAGCCCCAGAAAGCTCTCTGAAAGTTGGGCTCGTATGCATTTGCCTGCATTCATTTTCTTCGTCAGCAAGG
CCATTCTCTTGGGGCACTTCACTGCACTCTACAGTTTCTGTTCGTAATGGCGAATAGCTAGGCTCACCTCGTTCATGTACGCTCCCATGTCCGGCGCGAG
GTCCCTCAAGGCCGCCACACTTTGGTCGACTGCTTTGATGGCCTCGGCTTTGGCAGTCGCATTCAACGGCGGGAACCCCATTCCACAAGCTATTTTTTGA
AAGACTTGGTGTAAGCATTGCAGCACCCGACAAGCTCAGTCATGTCGGCAGAACGGAAATAGTAGTATACTCACTGGCATGGAGATACGCCCTCCTCCAA
GCTGGCAAGACTGCGTTTCCGCCGCCCCTAAGCTCTCCGTCCCTAACGCCCTTGCCGGCCACCAGATGCAATGTCGCCCATCCCCGAACTGCAAAGCGCT
GAAAGGCGTCTTTGAGCTTCTCTCGGCTTCCAGTGAGCGCTTGTTCGTCAAGGAGCCAGCTTCCTGCAAGCCCGTTATCGCCCACCGGGTTGGAGTCAAA
GTGAACCTGGATCCAGTCCCAGAAGCTACTGTAGTGTCCCATTTGGTTGGCGCTCAGGAACAAGCCAGGCCAGTTAGCTTGAATGTAGGCGTCGATGGGT
TGCCAAGGGTTAGCGACGCTGCCATTGTTCCCACCCGGAATGGTGAGGGCACCAAAGAATCCCGTTATTGGTCCATCTACACCAAACCCGGGGACTGTGA
GATTGACCACGGGATACAAGTATCCAGAAACTCCAGCCTTGCTCAGTCGAGGCATCTCGCTCAAGATGTATGCAACTAGATCCCAGATGGCCGTTTGGTC
GTCTAGGAGGGCGGGGTTTTGGAACAGGGCAACTGTCAGGGAGCTGATCTGAGGCGTTGGATATGTTTTGAGGGTGGCTGAAGTGATGATGCCGAAGGTC
GAACCTCCTCCCTTCACCACGCGAATCTAATGTCAGTCTCGGACAAGGAAGCAGTACAGGTTTGACGCGAAAATACTTACTCCTCGCATCGCCCAAAACA
GTTCTTTGTTATTGCACTCGTTGAGCACCTTTATATCTCCTGTTGGAGTCACGATTTCCAACTCGAGGACCTGATCGGCGGCGAGTCCATACTCGGTGCT
CAAGAGAGAGTGCCCGCCGCCAGTCAGATACCCGCCCACACCTACTGTGCTTCCGCTGCCCCCAACGACAGCCTCGTCGAACCTACTGGCGAACTCGTGG
ACCTGTTGCATCCGAGATGCTGCCTTGACGGTTATGGCGCTGCCGCTGTGTACGGCGCCATCTTCACTGCAACACTTGGGTTTGAAACTCCCGGCAGAGT
GGTGTTGCATTCCTGTCAAATGGTGCGTCCATATCGACAGCGAGTTTGGCGCCACAGACCGACCGACATAATCGTGCCCTGTTGCTTTGACAACCAGTCG
AATATTGTGCTTTTTGGCTACAGTGAAAAGCTTGTCAGCTGGCCCAGCTGGAAAATGCGAACGTATCATGTCGACCTCGACAAAGAACCTACCAAACTTG
ACACCAAGCTGGACATGCTCAACGGCCGATGCATTGACAACATAGACTGGATATCCACTTCCGCTGCATGGAAAGCTTGGATCCGGCAGGCAGGAGTCGT
TGGTCCAAGTGTTGCCCATCATGGAAACCGGGTCGTTGACGTGGAGTGCAAAGCCCTGCCAGCCGCCGGTCTGGACTGCAGCACAACGCTCGGCATTATA
AGAGGGCTGGTCTGGATGACAGACGGCACCCGGAGGAGTTGGTCGAATCAGTTGACCGCCCAGTGAGGTGTTGAATGCCTGCCACTGCTCCTCGGATGGC
CACTCGTGGGCGCCGGGCACGGCTTTGCATCTCGGGGCTTCTCGCTTGTGGTGATCCTCAGCAGAGACGTGCGCTGCTAGCAACGGCACAACGTGGGCCA
ATATCAACGGAACAAGCATCTTCTCGGAATTATGCAAGAACATGAAGGCTGGGCTAATGGTTTATTTGTGCCTTGAGGGTGTCTCAAGATGAGGAAAGAA
TGCCTCCCGACGACTATCTACACATCCGACCCCAATATGCAAACTCTGGACATTCCTCTCGTTTATTTATACTGCTCCTATTCATTCGGAAATAATAGGA
AACATTGCGACAAGATATAGGGTTCAACTCCACGCGGCCGGCCGGGTCATGGGGTTATTGTCAGCATTATGTGGAGGCATACTTGCTACAGCCTACAACA
AATAGGCCACCATAGGCAAGGCGGCAGGGATCGATACCCAGTGGTGGAAGCGACCTCATTGGTCAGACAACGGACTGTTTATCCAGAGCTGTGTTAGCGT
GTGCAGTCTCCGGGGTTTGTACCCGTGCCGGGAAAGCGATGGCTGAAAACCTGGACAGGCTGGTTGTCAGCCTGGAGAAGAGCTTGGCATCGTCAGACAT
GGACTGAGAAGACGTATGCGTTGGCGTCAACTTGGGCCATTTCCCAACAAATCGGGTTCATTGTAGGATCCTGTCAATTTAGATTGCTACTGGGCAAGGC
CTGAAGCCCTTGTTCTCGCACATGGCCACCTTCGCCGTCAACGTCACCCTCACCCTCACCGTCGCAACCCAACCCAACGCAAACAGAGTCTAACAGGTCG
ACCTGTGAACACCAGTTTCCATCCTGCCCGTCCTGCCGGTGGCCTGGTGTTTCTTGTGTCGATCGTCCCTCTCCTTCTTGGCCTGGGCTCTCCCCTCTTT
GCTAACATCGGCCTTGGTACAAGGCCCCTTGTGTCTGCTCCCTTGCAAGACGTTGAGGTCGAGCTCGTCCTCGTCCATCAGCTTCTGCGTCACCTCGCAA
ATGTCGGACAGGAGCCTGTCGAGCAGATCCAGCGACATGCTCTCGCGGACCACGACCCTCAAGATCTCCGTCTTCTCCTCGTTGGGCGGCAGCGCGTAGT
TTGGTATGATCCACTGGCGTGCGCGGAGCAGCACCGACACCGTCTCCTGCTTGACGTGTGGGAACTGGCGCCGGAACTCGTCCGAGAAGCAAAACGCCAC
CACGGGCAGGCCGGCCACGTAGTCGGCAGACGTCTCCTTTGCATGCTCGGGCGTCACTTCGGGCTCCTTCTGCTTGCCGTTGCTGCCGTTGGAGCCGGCC
GTCTCGACGCGGCGGTGGATGTCGGATACGCAGGTATACCACCCCGTCGCCTCGAGAGATTTGGACAGCAGCCTCGCGTTGGCCAGGCAGTTCTCCATGA
TGGCCCGGTAGCCCGAGAAGCCCAGATGGACGAGGTTAAAGTACTGCGTGATGACCTGGGCGCCGGGCCGCGAGAAGTTTAGCGTGTACGACTCCTCGGT
GCCGCCTAGGTAGTGCAGCTCGAAGATGAGGTGCTTGGGCAGGAAGGACTCGTCGCGCCAGACGATCCAGCCAACGCCGGCCGTCACAAGGCCGTACTTG
TGGCCCGAGGTGTTGATGGATTTTACTCTGGGGAGTGAGAAATCC
CTGTGTTTTGTTGGTTTTTGTCAGCTCTCAATCACGCCTTGAAGACTTTTTTTTT
TCTTCTTTTGGACACTAAAAACTTAC
CACTTGGGTCCACCAGCTTGTGCATGAGTAAAGGGGGCAATAAAAGCACCGCTTGCACCATCAACGTGGATTGG
GATATCATGCCCAGTCTCAGCCTGGTAC
CTAAACCCAGGAGTACGACCATGTCAGTATCTTCTGCATCTACCAACTGAAGAGTCCAACATCCCAATGTGA
CACTCAC
TTGTCCAAGATTTCGGAAATCTCCTCTATGGGCTCATAATGCCCCGTATAGGTGCTGCCCAGGATGATGAAAATCCCTATGGTGTTCTCGTCA
ATGTTGTCGCGCACCATGTCGGCATCGAGCCGATACCTGCTCTTTTCCGACACGGGCAGGATGCGCGCCTCGACGTCAAAGTACCGGGCAAACTTCTCGA
GGGCGACCTGCGCGTTGGCGCCCATGATGATGTTGGGCTTGCTGTCGTCCTTGCCGGCGGCCCTCCGCGCCTCCTGCCACCTGCGCTTCATGGCGAGACC
GCCGAGCTGGATGGCTTCCGAGGAGCCTGTGGTTGCGCTGCCAAT
CTATTTTTCAGGTGGTGGTTTTTCCTCCTTTCGTGATTAGATTTTCGCTGACGAC
GACTGGCAATGTACCGAGTGGGGGAATTGGTTGGCTGAGTGGCACGGCACATAC
CGCTTTCTCTCCTTTCTGGACGTTCCAGAGGTGGGCCAGGATGCTC
ACGCAGCGCTGCTGCATCGAAATCATGGCTGGGTACTCATCCGCATCGGAGAGGTTCTTGGCAATGTTCTCTACCATGAGCTTCTGGGCATTGTCTTCGA
GGTAGGTGCCCACGAAG
CTATTTTACAAAGAGGTTTGGGACAATTCAAAAGTCAGCTCGAGGTCAAAATTTCACTTGCAGCAGCTAGCTGGCTGCATGAG
CCGGTTGCCAGCTCGGTCGGAATTTAC
CTGGCCAAGTTCAGATTCGGCTTCCCGTCCAGGTCAAGCTCATCGCGAATCATCGAGTAGACCGTGTCGGCCT
CGGCGCCCTCCTTGGGGAGCTTGTACTTGGGCAGGCTCACGTTGCTCGCGTAGCGAGACGAGTACGGCGTCAGGTGGGAAATCGCAGCCTGGGTCCGCGT
GTCATTGTCGCCGTCCTGCTCCTTCAAAGACGAGTTGTGCAGGTGCTGGACAATGTCGTCCGGGTTTAC
CTGAAAGCCGGTTTGGGTTAGTGGGTTGCTC
TCTTGTTCTTCTATTCAGGAATGCCAACAAAAAGAAAACCCCCCGACTGATGCTTAC
ATGGCGTGAGAGGACCATGTTTGATTATTGTTCTCTTGACGAT
AATTGATACAGGTGGCAGGAATTGCAGTCCTTGGAACGAATGGGTTGGGGGAGAAGAGAATCCCCAGATGCCAATCACAGCAGAACGCCCACCTTTAAGG
CAAGTCTGTCTGACTAAAAACAATGTCGGAAGCTAGGCTCGACAACGCGTGAATTAGCCGTATGGGGTCAGCATCCGACTGCCACCAAAGCCCCTGCGAT
TAAAAGAAAAAGAAAAAGGGGAAAAAAAAGAAAAGAAAACACAATCTTGGGGTAAAAATATGTGAACAGTTCAATACTCAAACCGGTAGACCAACAGCAA
ACCCACCGCCTGCGAGAGGAGAAACAGGGACCGCAATGTTGGAAACATTCTTGCAGTATGTCAGGTTGAAGCCTTGGCTATCAATGTTTCCAAGCGTCGG
GTCGTCGTCCATGAGCTTCTGGACATGGGTATGATTGGTCAACCTCCATATCGAGTTTCGAGAGAGATCAACATGGACGTGGCTGTCACTGTGTTCCGCC
ACGGCCGACCCGACCCATTCAGACATTTCCTTCAGCTGCAAGTCAATGCCGCCCCTGCCGCTGACCACAATGTCACCTCTAAGGGAGGATTGTGCAACAC
TGAATATCATAGCTGTACTCTCGTCTCCAAAGTGCCTCTTTTCGAATCCGCTCGAGCCATCCCAGGCAGGCATGCCGGCGGCGACAGCTCGGACTAGAGT
ACCATTGGCTATGATTGTGCTCCGCGCCATATCCACCCTCCCTCCGGTGTTGCTGAGCCACATGCCCACCGCTTCGGGCTGTATAGCTTTTATAACCGTG
TCGTTCACCCTCAACCAGGGTGTAGGTCGCGCGTTCGGACGGCTTGTATTGTCAAACATGACGATGGCCGCAAGCCCGCCTGCCTCGGCCTCAACTTGAT
CCAGACTGATTACTAGACGGTCCTGCCAAACAGCCTTTGTACTGTCGACTACAAGAAATGGGCTCCGAAACGAGACGCATTTGAATTGCCGGACATTCAA
AGAACCACCTAGACTGAATAGGCATGGGCTCCCGGGCCCGAAGGTGAGCCCTTGTGAGTTTTCTATCCGGACGCGGGAGTACAAGGTCGATGCAGCCGCG
ATGCTGCTCCGAGGGCCTGTCGTTATGGCCGATATGCCGCTCATGTTGATGAAGCCGCCACCTGCAGCAAAGACCGAGTGTCCGACTGGGCTGCTGCTAG
ACAGCTTGGCGCCGTTCAAGGCAACCGAGGCACCATGGACGAAGAGGCCAATGGAGCCATCGTTGGCTTGGACGTTGACATTTCTCAGTATAGCGCTTGC
CCCGTTGGCCTTTTTCGATGATTGATCGATTATATGTCAGTGAGCTTCAATCATACCAGCATTTGGCGAGATGGCTCAGGCTACTGACGACATTCACCGC
AGCATTGGACCCCTAGGTCTCGGCAGCCAACATGTCGGAGCTTCTGCCCGATTTGACCACCTCCAAACCATCCGCCTCCCAATGCGTGCCACTGGGGACT
AATACGGTGACCATGTCATCTGCATCTACCGTAAAGTGGCCTTGTCGAGTGATGGAACTCTCTGGCGTGATAATCCATGCCGACTTGACTGGTCCTTGCT
GAGTGAAGTCGCTGGCGTTACGCGTTTCTTGCCACAGGCCGTCTGCTATGGTTTCTGCTGATGCCAAAGCGACATGGCAGACAAGGACTTTAATGGCAAG
CAGGAGCAGAAGCATGTTAGCGAGCGGGCTCAATGTAAACCAGACAAACGGGTCAAAGTAAAATGTTATAATGTTGGGGATACTAAATGTTCCGATATGA
ATGCCGCAAGGGATGCGAAGTTGGACTGGGCTGGGCTACGAGATTTGAGGCTTTCGGAGGGTTTCTGCAGAGTGTTGGCAGCATCAAAACTGGAGTGAGT
CGAGCGAGATATCTGCGTTCTTTTAGGTAGGTACCTACCTACCTTAGGTAGGTAAGGCAGGTAGGTAGGTAAGGTATGTACGTCAGCCTACCGCGCGAGT
TGAAGAGCAGGTGCCGCCCATATATTCGACTTTGGCACCTTCCTCAGCCAAGTGTGAAATCCATCAGGTCGCTACATCCATCCAATCCCAGCCCGGAGCG
TAGCAACCAGGAATAACCTACCCATTGTTCCCGCCACATTTAATGTCAAATGCCCGCCCAATATGGTAAGCCGGATATTTCGCATAGGCTAGGTAAGGTA
CTGTACTGTACGTATCGTAGGACTAATAATTTATTGAGCGTGACAGTTATATTCTTCAGCAACCAAATCTACCTAGCCAATCAGAGCACTACTTCCAGAA
CTACCTAGTTCTGGTCAAGCTGCCCGAGCGCCCTAGCGTTAAGCCTTGCGGCAGCCAACCTCGAAGCCTGCTTGGCCGTCCTCCCGGTCTGCTTGCCGGC
TCCCGTAGCACCACCCGCAGCAGCACCCGCGGCGGCAGCGCCTCGGCCGCGTCCAAAGGGATTCTCGTTGCCCACGACTCCCTTCAATACGGTCGCCACG
TTGATGCCCTTGACGGCGCCGTCGCCGCCCTGCATGATGTTTTTGTAGTTGTCGGCAACCAGCTGGATGCCCGAGACGAAGTCCTTGCCGTCAAAGGCGC
AGTGCCCGCCGTTGGGCGTCGCGTCCACCGTCTGCAACGCGTTGATCTGGTCTGTGCTGAGACCAGCGTCCGAGGCGAGCTTCTCGTACGCCTGGATGGC
CTGCGGGATGCTCTGCTGCAGGCTCGAGAGCTCCCGCTGGCTGCTCTGGAAGTGGATCTTTGTGGTTGAGAGGGTGGCGGCCGCGTCCTTGAAATCGACC
GCCGGGGGCAGCGCTCCGCAGTCGAGGAGCACGCCGTTGCCCTTGAAGTTGGTCAGGTGCGCGGGCATGAAGAAGCCCGACAGCGTCAGGGAGCCTCCGG
AAACACCGGTGAAGAAGACGTTGGACTTGTTGAACGCCACCATTTGGGGGAGGACATCCAGGATCAAGTCATTGACCGCCTGTGCGTCTGCAACGCCATC
GGGACGATCGTTACCAGCCGGCTGGCCCTGACGGTTACCCCAGAGAAGATTAACTAAATAAAACACGAGGTGGGAAGGTACCATGGGTTAGTGTGTTGCC
TGACTTAAAAAAAAAAAATAGAACAGAAGAACAAAGACTCACCCGACGGCGCAAGCACAACAACACCCATAAGGTTACCCTGAACGGCCTGGTTCGGGAA
ATCAAGGAAAGACTGTCCACCGTCTCCATGAAGCAGCACATTCAGTCCCAAGTTACCCTCGGCGCCGGCCTGTTGAGCGCCGCCCTGAACCCCCGAGGCT
GCTGTAAACTGGTCTGCAGGACCGCTGATCTTGAACCTCAAATCAGCGCCGTTGACCTTGGCCGTCATGTCGAGGATCGTGGACCCATCGGTAGCCTTGC
TGACACCCTGGGGAACCTGGGCAAATTGCTGCTGAGGAGTCTGTCTCCGCCCACCCTTCCTCTGCGCCTCGACGCCGCCGCTGAGGACGCCGAGGAGCAG
AAAAACAACAAGATTGAAAAACGAGCGAACGGTCAACATTCTGGCTCGTGGGGAGAAGCGAAATTAAAGAAGAAGAAAAAAAGAGGCAAAAAAAGGTGAA
ATACAAAACAGAAATAAAGCAAAGAAGCGGATGAAGAAAGGAAGAAAAGAAGAAGAAAAAAAAAGAAAAGAGGCCAAGCTCAGAAGCCAATAAGGGACAA
GGCGAGTAAGTGGGAACTACCAGTTCTAGATGCGGCACCCAAATATCTAAAAAGCCGTTGTCTGTCAAGTCTGAGACATGACGGGTCTTCCCTTGCATTT
GCAACCATCAGACAACCCTGTCCGGCGAAGAACCGGGGGTAAACTGAAAAGTTGGGGAAGCAGGACGAATTACTACTTGGGGCGATGCCAAGAGGCTACT
GCGTACACTGTAGTAGCCAACGTGTGCCAATGTGAGACACTCGGTTGCCCTATCACTCAGCACCAACCCAGAAAAAAAACATGGGATGGATGCTGTGCCT
GTAAAGCCCTTGCAGCGACCGGGCACAAAGTGCTACTGATACATACAGCTAAGTTGAGACTGGAACCTAATTTGTCCGGCCGCATTCTCATCTCATGTAG
AGCATGGTTTGCAATCAAGTCAGATCGGGGAAAGAGTGCTCTGGTGCAACAAGCTGGGTTTGTAAGATGAGCGTTTGTGTGACACTCGGCAGAAGTCTGT
TTTAACCATAAAGAGGTGCGTGTTTTAGCCAAAACCCCATGTGCTGTAGGGGGGGTTCGCGACTCTGTGGTTTTGGGTTGGTGGAACCTTGGACCCTGTC
CGTCTCCCTTTGTGATTTTACCAAGGTGAAAGCTGCAAGTCAATGACCAACAACCGCGCGGCTTTTTTTTTTTTTTTTTTTTTTTCAAAGGTCTCAATCG
ACAGCTTGAACCGTGTAATTTACTGGTTTTAGCACGACTAATTATGAGTGTCAGTCAAAAAGCAAATCTTTGCCGAGACACACAATGGTAGCAATAGCGG
ATGGGGGATAAACTCGAGAGGTGTTCCAGAAAATGACCCTCTCGAGCACAAGCGATGCCCATACTTTTTAATTTTCCCCCCAGAGCACAAAGCGCACGCG
CGCGCGAGATGCATGCTTGCCCAGATTCCAGAACCTCGGCGGAAACAATGTTGCATCAGTTCCCGTTCTCAAACGTGGTAGTGGACCGGGAACAGAGTGG
AGTGGCGGAAAATACTTGATACAAAAATAACTCTGGCAGTTCCGATTGAAAGGACGGAAACATATTTTACTATTAAGCGTTAACCCGAGAAACAAGTCGA
TAAAGCATTAGTCTTTAGTGCACACGGTTACGATGGGACCGTTAAACACTTACCTGAGAAGAAGAAGAAGAAAAGTCAAAATTTGGACGAAATCGAAATC
GGTTGCGTGACCCTCGAGGAGCGAGACTACCAGATCTTGTATGTACAAACGAGGAATCGACACAAGCAAGTGTCCTACAACTTGGAGCCCTGACTCCGCC
TCTTCTCCTTTTCCCTGTCCCGCAGCAGCCTCCTCAGGATCTTGCCCGACGGGCTCTTTGGGATCTCGGCGACGAACTCGACGCCTCCACGCAGCCACTT
GTACGAGGCCTTGTGCTCCTCGACGTGCTTCTCAATCTCCCTGGCCAGGTCATTGTCCGACTTGCCCTTGCTGTAGGCGGCGTTCTTGACCACAAATGCC
TTGGGGACTTCGCCCGAGTGGTCGTCGGGTATCTGGATGACGCTGCAGTCCTCGACGGCTGGGTGGTCGAGGAGGTGTGCTTCCAGCTCGGCGGGTGCGA
CTTGGTGTCTCTGTTTGCAACATTTCAGCAAAAAGAAAATAAAAAAGAAAAAGAAAATAGTCAATGTGAGCCCCGTGATCAACTCCAGACTTACCTTGAC
CTTGATCAATTCCTTTATCCGGTCCAGGATGACCAGGTGCTCATTACCACCCGGCGACAGCGTAAAGAGCACCTCGTCGCCCGTCCGGATCCAGCGACCG
TCCTCGTCCCACACAAACGTCTCGTGCGTCGCCTTCTCGTTGTTGAGATAGCCGAGCGTGACGGATGGCGACTGGACCCAGAGCTCACCAGGCGTGTCGA
GCTGCGTGACCTCGTTGCCGTTGGGATCCATGACCTTGGCCTTGACCCCCGGCAGAAGCGAGCCCGACGACCGCGTGTAGATGTCGTCTTCGCTGGTGCC
GGACACCACCGTTGCCGTCTCCGTCATGCCGTAGCCCTGCACGACGACCCAGTCGGGGTAGATCTTGTTGAGGTTCCCGACCGTCTCCTCGCCCAGGGGG
GCCGCGCCGCTGAAGACGCTGTGCACGCTGCTCAGATCGTATTGCTTTAGCTTGTCGTGGTTCTTGACCATCTGGATGATGATTGGCGGGACCTTTTTTT
TTGGTAGTTACTTTTGCGTTAGCGGTTGAACATGTCAAAAAGGAAAAGAAAAGAAAGTCTATCTTTTCCAACGTCTTTCTCTCAAATCCCCGCCCAACAT
ACCAGATAAAGCATTGAAATCTTGAACTTTTGGATCGCCCCGAGAAAGGTGGCCAGCTCAAACTTGGGCAGGGTGATGATCTCATCGCCCCTCCAGGTGC
CGGCGTGGTTGATGACGACCAGGGCGTAGATGTGGCTAAACGGCAGGAGCCCCAAGATGGCCTGCGTGGTGACGCCCCTCTTGGCGAGGCTGGGCCCGTC
AAAGACGTTGTACTGGAGCACGTTGGCGATGACGTTGCGGTGCGAGATCATGACGGCCTTGGGCAGGCCCGACGTGCCGCTCGAGTAGCAGAGGAAAGCC
GTCTGGCGTGCGCCGGTGCCCCTTGCCCACCTGAGCCGCTCCAGCTGCGGCAGGCTGCTGCCCTCCCGGATGAGGTCGTCGACCGAGACCACGGGCGTCG
AGGGTGCGGGCCCGGGCATCCACATGACAAAGATCTTGTCCCGGGCTATGCCGGCCTCCTTGGCGGCGGCCAGCGCCGTGTCGAGGAGCAGCGCGCACGT
CACGAGGGCCGAGGCCCCCGACGACTTGAGCTGGTGCGCCAGCTCCGGGACCGAGTACACGGCGTTGGCCGGCGTCACGATGCCGTTTAGCCTGTGCACC
GCGTAGGCGACGGTTTGATAATCAATCTAATACATGTATTCCGGGGGGCGTAAGCGCAAGCTTTCTTGTGGGGAAGAGGCAGAAACTTTGTCCTTCACTG
ACCGTGTTTGCCGAGAATATCCCAACCACCTTTTCCCAGGGTGTGTCCTGGTTGGGAGACCAGCCCATCCTCTTGCCCAGAGCTCTCGAGAGAAAGTCGG
TCCGCTGTTGGACCTGTAAGATGCTGTACGTCTTGCCGGTCAAGCCACAGGTGAAGGGATTCCTGCTCTCGGCCAAAGGTCGACGGCCGCATGTTTCATT
TTTAATGAACTCCTCAATGGTCATGGAGTCCGGGGGGTCTTTTGTTTTCTCTGGTCAGCTCGTCATCGCTCTGGGGTACTCATCAAATCCTGCGAAGCCG
TCGCCGACCTAGATCCAAAACTCACCGAACGGCAGTTTCGGAATGTACTCCGGCGGAAAAAAGACCATATTTGCTGGTTTACAGATATGTATACGTAGGT
AGGTAAATGTCTAGATACGTTTGATGTACAGTTCAGACACTGGCAGGGAACAAGCTTGAAAGAATAAATAAAGTAATTAATCAATGCAAGCCCAGGTGGA
AGAGGGAAAAAAGGGAAAGGGAACCAAACACAGCCCGCACGGCCTCTCGCACAAAAAAAGCCTACTGCTGGGACACGACTCTTTTTTGTGTGTCCTTCCT
TCCCCAACCAGCATAGCCGGCACAACAGTGAGGAGAAGCAGTTCGACAAAGCCGAGCCGAGTGGGTCTCTCCCCCAGGTTTACCACTTGAAACCCCGCAT
ACCAAGAGTTGGAGGGTATGACAGAAAGTGGACAATTCGGGGCTGTCTATGGGGAACATTGCCGCCTTTTCTTTCTTGGCCACGAGCGCATTGGAAAAGA
TGATGACTGAATAAATTAGCCGCATTCCGTTTCTGCCACGGGCTTACAGAGTGTATTAGGTACCTATTAAATAAACCCACATGATTTCCATGACGATAAA
TCTTAGCAGAGTCCTTTTCTCTGGTGCATTGCACATCAACTCTTTTACCATGCACGCAATACAGAACAGTCCAGACAACAAAGCATTTCTTTCAGCTCAT
TCTCGATTCAACACATCATGTGGGTAAATCTTTCATATATCACAAAATACAATCCCAAGTCCTGAGATTCTTTTTCCTCCCCAGCTAGGAAAACACTTTG
ATAAAATTACAATTTCGAAGCGGGCCTGGCGCTTCCGGGTGTCGTGATCTCGTTATACAAAAGCCTGTCATGACATGTTAGCATCTTGAAAGATTTGTGG
GGAAAATAGCAAAAAAACCTGAAGAAAGAAAAGAAAAGAGTATACTCACGTTGTCAAAAAGTCGGCATAATCCTCGCCGGTAACCTGGGTGGCAAAGTAC
TGCGAGGCCAGCTGCATCTTGTTGCCGGCGGGCAATGACTTGGCCATCTTGTCTGCCTCCTCCCGCAAGAGACGGAGCGCATACGACTTGTCAACCTTTT
TGCCCTCTGCGGTGCTCACGCCGTGCTTGACCCACTGCCACAGCTGGCTGCGGGAGACTTCGGCAGTCGCGGCGTCCTCCCTATTTATTGATCCTTGTGT
GAGTAGATGTGTCTGGCACAAAAACATTTACCCGGTTTACCTCGGCAGCTCAGAAGATTGGGGGGCCGAAACGACAAAAACAAAAAAAAAAAAAGAACAA
AAAAACTCACATCAGGTAGTTGATGGGCACGCAGCCAACGCCGCGGATCCAGGCCTCCATGTAACCGAGACCAATGTACAGGTTTTTCCTGATTCCATCC
TCGGTGATCTTGCCCGGTACATTCATGTTGAGCAGATCCATGGCCGTAATGTGCACGTCCTCGCGCCTCACAAACAGCTGGTTGGGCGTCGGCATGTGCT
TGTTGAAGATGTCTGAAGCGATGGCCGCCAGGGCCGGGTGGGCAACCCAGGTACCGTCGTGGCCCGCCCGCACCTCGCGCAGCTTGTCGGCCCGGACACC
ATCCATGGCGCGGTCGTTGGCCTCCTTGTCGTCCTTGATGGGGATCTGGGCAGCCATGCCTCCCATGGCGTGCACGCCGCGCTTGTGGCAAGTCTGAATC
AGCAGCTTGACGTAGGCGTCCATGAAGGGCACCGTCATGGTGACAGCCGAGCGGTCGGGCAGCACAAAGTTGGGGTGCTGGCGGAACTTCTTGATGGTGC
TGAAAATATAGTCCCATCGGCCGCAGTTGAGGCCGGAGCTGTGGTCGCGCAGCTCGTAGATGATCTCGTCCATCTCGAACGCAGCCAGGATCGTCTCGAT
GAGCACCGTACCGCGGATCGTGCCACGGGGCATACCAATGTAGTCCTGGCCTAGGTTGAAAGCATCGTTCCACAGCCGAGCCTCCAGGTGCGACTCCATC
TTGGGCAGGTAAAAGTATGGACCGAACCCGCGCTTGACTGCCTCATGTGCGCTATGGAAAAAGTAAAGACCAAAGTCGAAAAGCGATCCACTGATGGGCT
CTCCGTCGATGGTCACATGCTTCTCCTCGAGGTGCCATCCACGAGGCCGCACAATGAGCGTTGGTAGAGTCCTGTCAGTCCGCAGCTTGTATTCCTTGCT
GCCCTGCTTGAAGTCCACCTGCCGACGAACGGCGTCGTACAGGTTAACTTGCCCGTTGATCATGTTTTCCCATGTGGGAGCGCTGGAGTCTGCTCCGTGG
CATTGACAACACAAGGTTAGACAAGGGCCTATTTATGCCTGCTATCTTACTTGGAACCGAGGTACTCACCCTCAAAGTCGGCCATGTACGTCCACACATT
TGAGTTGAGCGCGTTGACAACCATCTTCCGGTCCGTAGGGCCCGTGATCTCGACTCGGCGATCAACCAGGCCCGGCGCCGGCGCAGCTCCCTTCCAGGTC
GAGTTCTCTCGGATATGCCTGGTCTCGGGCAGGAAGTCTGGAAGAACGCCCTTGTCAATCTCGGCCTGGCGCAGCTTTCTGCGCTCCAGCAGCTGCTTGC
GGCGCTCGTTGAAGGAGCGGTGAAGCAGGGCGAGAAAAGCCAGAGCAGGTGGTGTCAGAATCTTGCGCTGAGACTCATTGACCGTGCCCAGGACGTTGAC
GCCCTGGAGTATGGACTCTGTGGAAGCCATGGTGGGCGCTGTGTGCTGTTGTTGTCTTGTAAGGTGGTGAGGATGCCAAGTAGCAGGCCTGTTCTGTTTG
Copyright 2006 Fungal Plant Pathology Lab. & FBL
E-mail : yonglee@snu.ac.kr
Magnaporthe oryzae ATMT Database