Home   Guide to ATMT Database   Sitemap   Contact  
Sequence ID  5333338
Locus Name  MGG_02722.5
Gene Name  
Protein Name  hypothetical protein
Species Name  Magnaporthe grisea [Magnaporthe oryzae 5 PROTEINS]
Protein Sequence
[458 aa]
+  1
101
201
301
401

MAVVDAAARKRVLRVIFISLLLDLISFTFILPLFPKLLEFYRNSEAPTGLLDKRPRTLLSNVLDYLNAYKAAFARPIDSRYDIVLLGGALGSLFSLLQAIASPIIGQLSDRYGRRTALLSSMMGNILSVLLWVMAVDFRTFVLSRVVGGLSEGNVQLATAIATDISDESSRGSTMALIGACFSIAFTFGPALGAYLSSIPLVAANPFATAAGFSLFLIVAETIYLYAALPETLPALTETKKSASAKGNDTTTKPKSAVRTNSHFMLNATHLFFLLFFSGMEFSLPFMTYDLFGYTSAKNGRLLGYIGLVASILQGGVTRRLPPLMTVRVGVVACLLAFGILSRASSVAALYVAATCLATTSATVVTGLNTLSSLEAGEAERGGKLGNLRSWGQLGRGLGPVLFTSIYWWAGRETAYTIGALGIAGVSAGVFMGLKSPPGFGKAGASQAQNGAGEKKDL
ASPIIGQLSDRYGRRTALLSSMMGNILSVLLWVMAVDFRTFVLSRVVGGLSEGNVQLATAIATDISDESSRGSTMALIGACFSIAFTFGPALGAYLSSIP
LVAANPFATAAGFSLFLIVAETIYLYAALPETLPALTETKKSASAKGNDTTTKPKSAVRTNSHFMLNATHLFFLLFFSGMEFSLPFMTYDLFGYTSAKNG
RLLGYIGLVASILQGGVTRRLPPLMTVRVGVVACLLAFGILSRASSVAALYVAATCLATTSATVVTGLNTLSSLEAGEAERGGKLGNLRSWGQLGRGLGP

DNA Sequence
[1377 bp]
+   1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
ATGGCGGTTGTTGACGCCGCCGCCCGCAAAAGGGTCCTCAGGGTGATATTCATCTCCCTGCTGCTGGATCTGATATCATTCACCTTTATCCTTCCACTGTTCCCGAAGCTGCTCGAGTTCTACCGAAATAGCGAGGCGCCCACTGGCTTGCTAGACAAGCGGCCCCGTACCCTACTGTCGAACGTCTTGGACTACCTCAACGCCTACAAAGCCGCCTTTGCGCGCCCCATCGACTCCCGATATGACATTGTACTGCTTGGTGGAGCTCTGGGGAGCTTGTTCTCCCTGCTCCAAGCTATCGCATCCCCTATTATCGGTCAACTCTCGGACCGCTACGGCCGCCGAACCGCACTTCTCTCCAGTATGATGGGCAACATTCTTTCCGTGCTGCTCTGGGTCATGGCAGTCGACTTCCGCACCTTTGTCCTGTCGCGAGTCGTCGGCGGTCTGTCAGAAGGCAACGTGCAGCTCGCGACCGCCATCGCTACCGACATCTCCGACGAGAGCAGCCGAGGCTCTACGATGGCCCTCATCGGGGCCTGCTTCTCCATCGCTTTTACGTTCGGCCCCGCGCTCGGCGCATACCTCAGCTCCATCCCCTTGGTGGCAGCGAACCCGTTTGCGACCGCTGCTGGCTTCTCGCTCTTCCTGATTGTGGCCGAGACGATATACCTGTATGCTGCGCTTCCCGAGACTCTGCCGGCTCTCACCGAGACCAAGAAGAGTGCGAGCGCCAAGGGTAACGACACTACCACCAAGCCCAAGAGCGCCGTCAGGACCAACTCGCACTTTATGCTGAACGCCACGCACCTCTTCTTCCTGCTATTCTTCTCGGGCATGGAGTTCTCGCTGCCCTTCATGACGTACGATCTCTTCGGCTACACCTCGGCTAAGAACGGGCGCCTGCTCGGCTACATCGGCCTGGTGGCCTCGATACTGCAGGGCGGTGTCACGCGGCGCCTGCCGCCCCTCATGACTGTCCGCGTCGGCGTCGTGGCCTGCCTGCTGGCCTTTGGAATCCTCAGCCGCGCGTCGTCCGTGGCGGCGCTCTACGTTGCCGCAACATGCCTGGCCACGACCTCAGCGACCGTCGTGACGGGCCTCAACACGCTCAGCAGCCTCGAGGCCGGCGAGGCGGAGCGCGGCGGCAAGCTGGGCAACCTGCGCAGCTGGGGCCAGCTCGGCAGGGGGTTGGGGCCTGTTCTCTTCACGAGCATCTACTGGTGGGCCGGGCGTGAGACGGCCTACACGATCGGTGCGCTGGGCATCGCGGGCGTCAGCGCTGGTGTCTTTATGGGGCTCAAGTCGCCCCCTGGGTTTGGGAAGGCTGGTGCTAGCCAGGCGCAGAACGGCGCCGGGGAGAAGAAGGACTTGTAA
TCCCGAAGCTGCTCGAGTTCTACCGAAATAGCGAGGCGCCCACTGGCTTGCTAGACAAGCGGCCCCGTACCCTACTGTCGAACGTCTTGGACTACCTCAA
CGCCTACAAAGCCGCCTTTGCGCGCCCCATCGACTCCCGATATGACATTGTACTGCTTGGTGGAGCTCTGGGGAGCTTGTTCTCCCTGCTCCAAGCTATC
GCATCCCCTATTATCGGTCAACTCTCGGACCGCTACGGCCGCCGAACCGCACTTCTCTCCAGTATGATGGGCAACATTCTTTCCGTGCTGCTCTGGGTCA
TGGCAGTCGACTTCCGCACCTTTGTCCTGTCGCGAGTCGTCGGCGGTCTGTCAGAAGGCAACGTGCAGCTCGCGACCGCCATCGCTACCGACATCTCCGA
CGAGAGCAGCCGAGGCTCTACGATGGCCCTCATCGGGGCCTGCTTCTCCATCGCTTTTACGTTCGGCCCCGCGCTCGGCGCATACCTCAGCTCCATCCCC
TTGGTGGCAGCGAACCCGTTTGCGACCGCTGCTGGCTTCTCGCTCTTCCTGATTGTGGCCGAGACGATATACCTGTATGCTGCGCTTCCCGAGACTCTGC
CGGCTCTCACCGAGACCAAGAAGAGTGCGAGCGCCAAGGGTAACGACACTACCACCAAGCCCAAGAGCGCCGTCAGGACCAACTCGCACTTTATGCTGAA
CGCCACGCACCTCTTCTTCCTGCTATTCTTCTCGGGCATGGAGTTCTCGCTGCCCTTCATGACGTACGATCTCTTCGGCTACACCTCGGCTAAGAACGGG
CGCCTGCTCGGCTACATCGGCCTGGTGGCCTCGATACTGCAGGGCGGTGTCACGCGGCGCCTGCCGCCCCTCATGACTGTCCGCGTCGGCGTCGTGGCCT
GCCTGCTGGCCTTTGGAATCCTCAGCCGCGCGTCGTCCGTGGCGGCGCTCTACGTTGCCGCAACATGCCTGGCCACGACCTCAGCGACCGTCGTGACGGG
CCTCAACACGCTCAGCAGCCTCGAGGCCGGCGAGGCGGAGCGCGGCGGCAAGCTGGGCAACCTGCGCAGCTGGGGCCAGCTCGGCAGGGGGTTGGGGCCT
GTTCTCTTCACGAGCATCTACTGGTGGGCCGGGCGTGAGACGGCCTACACGATCGGTGCGCTGGGCATCGCGGGCGTCAGCGCTGGTGTCTTTATGGGGC
Position in Contig 1677576 ~ 1679138 (1563 bp, 186 bp) in Magnaporthe grisea 70-15 supercontig 5.193 (Strand -) (Frame : -2)
Chromosome Chromosome : Not defined!
Contig Sequence
(1667501 ~ 1689100)

+1667501
1667601
1667701
1667801
1667901
1668001
1668101
1668201
1668301
1668401
1668501
1668601
1668701
1668801
1668901
1669001
1669101
1669201
1669301
1669401
1669501
1669601
1669701
1669801
1669901
1670001
1670101
1670201
1670301
1670401
1670501
1670601
1670701
1670801
1670901
1671001
1671101
1671201
1671301
1671401
1671501
1671601
1671701
1671801
1671901
1672001
1672101
1672201
1672301
1672401
1672501
1672601
1672701
1672801
1672901
1673001
1673101
1673201
1673301
1673401
1673501
1673601
1673701
1673801
1673901
1674001
1674101
1674201
1674301
1674401
1674501
1674601
1674701
1674801
1674901
1675001
1675101
1675201
1675301
1675401
1675501
1675601
1675701
1675801
1675901
1676001
1676101
1676201
1676301
1676401
1676501
1676601
1676701
1676801
1676901
1677001
1677101
1677201
1677301
1677401
1677501
1677601
1677701
1677801
1677901
1678001
1678101
1678201
1678301
1678401
1678501
1678601
1678701
1678801
1678901
1679001
1679101
1679201
1679301
1679401
1679501
1679601
1679701
1679801
1679901
1680001
1680101
1680201
1680301
1680401
1680501
1680601
1680701
1680801
1680901
1681001
1681101
1681201
1681301
1681401
1681501
1681601
1681701
1681801
1681901
1682001
1682101
1682201
1682301
1682401
1682501
1682601
1682701
1682801
1682901
1683001
1683101
1683201
1683301
1683401
1683501
1683601
1683701
1683801
1683901
1684001
1684101
1684201
1684301
1684401
1684501
1684601
1684701
1684801
1684901
1685001
1685101
1685201
1685301
1685401
1685501
1685601
1685701
1685801
1685901
1686001
1686101
1686201
1686301
1686401
1686501
1686601
1686701
1686801
1686901
1687001
1687101
1687201
1687301
1687401
1687501
1687601
1687701
1687801
1687901
1688001
1688101
1688201
1688301
1688401
1688501
1688601
1688701
1688801
1688901
1689001
AGGTTATAGTTCAAATATTCCTTAATTACAAGGACAAATATCTGGTATATGTTAGCTGACCTCTGAATCTTGTTGTAGGGACGGCAAGTCATGTTAGAGA
TGTAAGTACAACGTCCAGTTTACCTAGTAGTTTCGCGAGCCCATCTGACTTTGAGATTTAGCCTCGACACCGCCGGCACGGAACAGTTCGGTATGTGTTT
TCACCCAGATTCCCTTGCATGGAGGAGGGACTCTTTCGACTGACCAGCCTGCCACAGTTGCTATGCGAGATCTCTATATGAAGACAGGCCAGGGCTTTCTCCTCGTCTTCAGCATTACGTCACAGTCATCACTCGCAGAGCTAGCACAGCTGCGGGAGGAGATTATTAGGATAAAAGACGACGAAAAAGTGCCAATAGTCATATGCGGCAACAAGGCAGATCTGGAGGAGCAGCGAGCCGTCCCCCGAACCAAGGCGTTTGCCATTTCACAAAGGTGGGGAGCGCCGTATTATGAGGCGAGTGCCAGGACAAGGAGTGAGTAGGCCCATCCAGATCTTATGCCGGGTCAAAATGTCCCACATGTGAACCCTCAACTCAAATCATGTGTTGCGCTGACTGGGCACATCGCGATGAAGCAAACGTGGACGAGGTCTTTGTTGATCTATGCCGGCAAATGCTTCGACGGGACCAATCCTCACCACACGATTCGTTCCAAGACGGTGACGAGCGTACCGACGGATCCGGGGGCTTCGGCTCCAAAAAAAACGCAAAGAAGCATGGAAGGCGCACGCGGTGCGTCATACTGTGACCAAGTCCTTTTTCTCGACTTGACCTGTTTTATGCGGTTTCTCTATCGACACGTTTTCGATGAAAATGACTCTTTTTCGTACACCTTTCGAGCCTTTCTACCACCTACCTACCACATACCTTACCTATCTTGCTTTTTTAAATCAGTTTCTCTAAGAAAAAGGCGAGATTGCAAACGAGGAGAGCGCAAGCTCCAGAATTGTTTTTCATTTTTATATATATTCCCCCCAAATTGTTTTTTGTTTCTTTGGATGGCTTTGGCATTTGTTTGGCATATGGATCTTTTATGGTTATTCCTTTTGTGGAAATGGGACAGGCGCTGGTTACCATGATCATCTTTTCCTTTTTATTCTTTATGTTTCCCATTTATGGCTAAACAAACCGCGTTGGACTATCTGTCTTCTTTATATCTTGGGCAGTTTACAATATTGACACCGTCACCATGATCAGAGACGTTCTCTGTTCCATCATCGGGCAAAAAGCCTTCCATATCTCGACTCCTGGATGATGATAATGAACCATACTTGAGCCGGGACAATGAGCGGCTTGGTGACACGCTCAATCACACCAAGGTGGGCAATATCAAAGTGTTTTTCTGGCATAAAAACTATCAAGATATATACTAACGGTTGTATTGTATTTCTTCTATTTGCATCGATAAGCCTGCTTCAGATAGCTAAGGTACCTGGGTAGGTACACCTACCCTGTATCAGCTCTGCTGCAACGACCGAAAATCGGAGCATCGTAGCTCCAATGCCCCTCCACCCGTATACGCACATATCCGGGGTGCATGTTCTCAAGACCTGCCTTAGTTAATGTCTATACTGGCAGCAATCTTGCTATTCGTACCTCATTTTTCTCATTCCTGGCAACTTGCCATTGGGATTGAAGCCGAGATCGATGGGCGTTATAACTATACATCAATCCTCTACCGCGCATGCTGCAATCACTAATCCCGACCCCCTTGCCTCAACAGCAACATCTCTCACTTACAGTGGTTTTCACGGCGTGCCGGTCACCATGCGGCTTCGAAAGACTGCCGTTCGTTTCCAGCCCATCGTTGTTTTCAAAACAGGCCTCCTGCTCCTCGCCCACACCATCACAGCGACCGCCTTTGGACTCGAGAAACACCTGGATGTCCGATCAGCGTCGATATCCTCCCTCCACGACGCCCTATTCTCGGGCCAGACGACATGTCGCACCATAATATCGGCACACATCTCCCGAATACAGGCCTTCAACCCGATCATCAACGCCATCACGGCCCTGGATCCGGCCTGCCTGAGCGCAGCCGACGCCCTCGACGCCCAGCTGGCGGCGGGCAACGTCACGGGCCGGCCGCTGTTCTGCATCCCCGTCCTGCTCAAGGACAGCTTCGACGCCGCGGGCATGAGCACGGCGGCGGGCTGCCTCGCTCTGGCGCGCAACCGGCCGCGTGTTGACTCGCCCACCGTCGCGGCCCTGCGAAGCGCCGGCGCCGTCGTCCTCGGTAGGGCCAGTATGCACGAGCTCGCGCTCGAGGGAATATCGGCGTCGTCGCTCGCTGGCCAGGTCCGTAACCCATATGACCTGCGTCGGACACCGGGGGGAAGCTCTGGTGGGTCCGGGGCGGCGGTCGCGGCTGGGTTCGCTGTGCTCGCTACGGGGACAGATACCGTCAACAGTTTGAGAAGTCCTGCGAGCGCGAATGGGCTGTGCAGCTTTCGGCCCACGACTGGACTGGTGTCCAAGGAGGGCATCGTGCCCGTCTCAGCTACGCAGGACGCCATCGGGGCGATGGGGAGGAGTGTAGAGGATATCGCTGTTGCGTTGCAGGTGATGGCTGGGGCGAGGGGGGAGGATGTGCCGGACGAGGTTGTGGGGACTCATTACGTGAAGGAGATGATGGAAGGGGACGGACTGAAGGGATTGAGGCTGGGTGTTGTGGATGGCTTCTTCAACCATACCGCCGACCCCGAGACAGACCCTGTAAACAACGCCATGGAGACTATGATGTCGCTTCTCAAGAATGCCGGCGTGACTATAGTCAACATCACAGACCCGGTTTTCGACGCAGTCTCCATTCTCACCAGCCTCGACGTGCAACGCTTCGAGTACAAGGAACAGTTGGGCCTGTACCTCGGCCGAACCGATCTGGACGGAGAAGATGTGCCTCGGTCCTTTGATCAGCTATACCACGGCAACAGAGAAAGCCAAGACTTTGTGGTCCTGCCCTACCAATACGACTTTATCAACAAATCCTCGACAGCCTCCACCTCGGACGATGAATACAAAACCCGCCAGGCAGGCATCCGCAGGCTCACTGAGCATCTGGCCGCGACGCTTGCGACGCACTCGCTCGAAGCGCTCATCTACCCGCAGCAGAAGAACCTCGTAGTCGAGATCGGGTCGCCCTCCCAGGCCGGCAGGAACGGGATCCTGGCCGCGCTGACGGGATCTCCAGTCGTCGTGGTGCCTGCGGGATACTCGCCGGAGGAGGGTGGTCGTGGTGGAGTGCCGATCGGGATGGAGATACTCGGGATGTCGTGGACCGAGGGCCGGCTTTTGGGGATCGCTCGTAGCATATCGCAGCTGCCTGGAGCGCCGGCTTGGAGGATGCCCGGGACGGTGAATTCGAGCGTCGAGGTTCGGGCGTATGAAGAGGTGCCTGTTATTGTGCCTGATAGGGGCAGTGTCCCGCCAGAGTATCCGCTTGGCAACTTGTGGCACGGGCCCGTGTGAGTTGATAGCAACTGCTTGTGCGCTAGGGAGTTTCTGAGGTATTTTGAGTAGAACCAGGCTTTAGTTATAACGAATTAGATATATACATATCTATACCTCAAGCTCATAGCAGATATATCCTCGGTCAAATAGAGCAAGACATGTACCAGCACCCAGGACACCTAGTTCTAGATGTCCTTCACGGTGTACTTTGCAAGTAATTTTTTTTCTTCTCTCTCTCTCGCTATCATCCAACGTCTATGGAGCAATGCTCTTAATGTGCCTGGTATGCAACTCATCAACAGCAGGGATGATCAAACTCTCTATCTCCATCTCGGGTTCACCCTCGGGCAGACTAGCTGGATCCAGGGGCATTTCGGCCACTCGCATCTTGGCCTCGGCGGCGCCGACCATGTCCTCTCTGCCGCTGACGGAGCCCCTCCTCCTGCCGGTGGGCACGCGGATCCAGCGATCGGCGGCGCCGGGGGCGACAAAGACGACCTCCCACTTGCGGGTGGAGAGGAGGTTGCCGATGACGAGGTGATGCTGGTAGCGGTCGAGCGAGTAGCGGGCCTTGTGTACTAGGATGGCCGGGTCCGTCTCGAGCTTGAACGAGACGATCATGCCCTGCGGCGCCCAGCCGTCGACCAGGTTCTTGAGGAACTTGGGTACCGGATCCAGGTCTACAATCAGGCGCTTGGAGCGCGGCACGGCGGGTGACGAGTCAAAGTTGTCAAACGTCTCGTCGTCGGCGGCGGCCTGCTCCTTGGCGACGGCCGTGTTGAGCTCCTCGGCGCTGAGGGTGGTGGGCTGCTGGAGGGGCTGCTCGCCCGGAGGGATGGGAACGATGGGGAGGGCGCCCAACGGAGGCGCCGCCTGCGCCTGCGGCTTTCGCTCCGTGCTGCTACTGCTGTGCTTCATCCTCTCCACGGCCGTGGTGGACTGGATCTTGTGCTCGGCCATGCGCTCCGGCGGGACGAAGAAGTCCGACACGGCCGCGGCGAGGTACAGCAGACCCCTGGGTCCGAGCGGGCGCATCAGCTGCGCGACGGCCCTGAGCTCGTACAGGTAGTCGGTGATGGTGACAAAGGGCAGCATGAGCAGCATGTTGCCCTGCTTGGCGGCGCGGTACTTGCGCAGGACGCCGAGCATCTTCTCAGCGCGGCCCGGCTCCGCCACGACGGCGCCGTTCTCCTCGTGCAGGAAGTCGAGGAAGCAGTCGGTCGGTGTGTGGCTGTAGTGGCGCGAGTAGGGCAGCAGTGAGAACTGACGGTGCAGGAAGATTACTGCGTAGCCGGCCTCGAGGAAGTACTCGGCCGAGGTGGCACCGCGGGTCCCGGCGCTGAAATTGTCAATGAAGCGCACCGTCTGGCGCTCCAGGGGCACTGTCGTCCCGCCAGAAGTCACCAGCACCACTCGGCGGTTGGCGGCGGCGTGCTGCTCGATGAAAGCCGAGGCTAGCGCCACATGCTCCGACAGACCCCGCGGCGGCGGGTTGCTGCTGAAGTAGTGGTCCTCCTCGGCCGCTGCGGAGGGTTCTGCACCAGCCGGTTTAGGCGGTTGTGGTACGTTGGACATGGCTGCAATGACTGGTTATAGGTCGATGCAGGGAGCGTACAAGACTACACTTAATTTTGTGAAAGGGGCTGGCTTTCTGGGGGGTTTATTGGGGGAAATGAACCATTAATTGCGACGGTCTATGGTCTGATGTCAAACCCAAAAATAAGCAATAGCGGGTCGAATGATTTGTTTCTTCAATTGAGCAAAAAATGATGCAGTGGCGATTGGATTGATCAACTGCTGGATAGTACCTGTCACTTGTCAATTCCGCCCTTTGTGCTTGGTACCTATTATTGCACATTCAATTGAGCAGTGGGATCGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGCGATACCCTTCAACCGCTTGGTACGGGGTATTTTTTATTCATACCAGGTTTGACGTAGACTGATAATTAATTCCCTTTGTTTGGCAAGATTCAATTGATATCTGGATTGTTGAATAAAATCGCTCATAATATCTATCCCAAAGAAGAAAAAAGACAAATGACACAGAAGAGCTGTTGAGTTTGTTTTCTCATCTGGTTTCTTTTGTCCTCCGAAAACGCCTATAAAATGCCTGCAAGATGCCTGTAATATATGCCTGCAATACACCAGAACTGACCGCCAAAAAAAGAAAGAAAAATTCCACTACAGCTCACAAGCCAAACCATGTTTACTACCCCTCCTTCAAATCAAAAGAAAACCCAAGGCTTCCACCCTACAGAATAAACCTTTGCCGACACGAAAAACACTAGCGACAGCAGATACAACAGGCCCGTAAACACAATCAAGCCCCAGTAGTCGCCGCCGCACGCGGCCAGGATATTGCCGCCGATCGGGATGCCGACCAGGCAGGCAAACGACACGAGTGTGTAAGCCGTGGCGTAGTAGCGGCCGTAGTTTTGCGTCTTGCACAGCCGCCCGATGCAGAGCGGCGTGAGGCTGATGTTGGTCCCGCTCGCGAACCCAAACAGGATCGCAAAGACGACGATGCCCGCCGTCGTCCCGCCCGCCGGCAGCCAGATGGCCAGGCAGGCGATGAGTGACTGCAGGATGGCGATGATGTTTGCGTTGGCGGGACCGATGATGTCTGCCCACCAGCCCGGCAGCGCCCGGCCCAGCACCGAAGCCGCGTTTAGCACGGTCAGGATCTGGAACGAAAACGCCGCCGAGAAGCCCTGCGCCTTTGCGTACAGTGATATGTAGCCCAGCGGGATGAAGAGCGCAAACTCCATGAGGAAGATGCCTGCCGTCGTCAGCGAAAAGGCGACGTTGCGGAAGATGCGCGGGTCCGGGTGTGCGCTGGCGTTCTTGGCCGGTGGCAGCCGGGATCGGATCAGGAAGTTGGCCGCAACTGCCAGCGCGATGCTCACGAAACCGAGCACTCGCACCGCCCATGCCCAGCCCACCCTCTCGAAGAGGTCCGACAGCAGAAGTGGGAACACGACACCGCCGACGCCGCCGCCTGTGGAGGCGATGCCCGTTGCCAGGCCCCGGCGGTCACGGAACCAATGGCCTATGGCGGTGATGGCGGGCGTGAACATGAAGGCGGTTCCCAGGCCATCAATCAGGCCGAAGGCGATGACAAAGTGCCAAAATTCTGTATGATTAGCATCTGGTCAGCTGACAGTCCATCAAGCAGAGCAGAAAATGGTGGTAGTGTCGGAAGCAACCTGGCCTGGTACCAGTTCAAACTTACCGGTGCATATGCTGAGTATCATGGTGCCCACAGCCAGCAACACAGTTCCGAGTAATATCAGCCACCGCGGCCCATATTTATCGAATATAGGACCAATGTAAAGCCCCATCCCAAAGGACAAAAAGGTATATATCGAAAAGATCCAACCGACGGTGCCCTCAGAGTAGCTGGATAGTTGATTTTGCGCAACATATGACTGCAGCACTCCAATGGTGTTCATAAGACCCAGTGATGACACGAGCGCCATCCAAGATCCAAGGACAACGAGCCAAGCGCGCAGTCCGCCTTCAGGGTACGTCTCCTCCTCTTCATCCTCCTCGTCTGGGTCATCGCCCCTGTTGGGAGCATCGTCATCTTTCCCGGAACCGGCGCCGGCTTTCTTGCTAGCCGCCTCGACAGCCGGGTCCCTGCTGGCAACGACGAACAGCTCCGGGTTCAAGTTTGGCTGTGGGTAGTCTTGTCCAGCCTTTTCCGAGTGTGATGTGGGTGCGTGTTCTGGTGCTGCTGAATTCGTAGCGCTAGCCTGAACGGCATCACCGCTACCCGTGTTCGTCTCAACCATGGCCGTCCTTACTACAGCCTGTCGTCCAAAAGACATGAGAACAAATTTATGCTACTGACTCTCATGAGCAACCATTGACTAGATCAAGAAAGGTCGCACAAGTCAATGCCATATATACAATGGTAAAAGCCCGTTTATTGTGTATAATACTCCTCACGAGTACACCCTCATGCAATGGTGTGAAAGCAAAAAACCACATTTTGGGCAAGTAGATTGGGGGATGTTAGTGGATAGGGTAATGTAATGTGCGGCAAAAACTACTAGGAATCCATGACTCCTCATTTAGGTAATGAAATCGGCGCTCGGGAATAAAACTTTTTTTTTCTCCTCTAGCTAAGCGATGTAAGTCAGCTAGCTCGACCTTGCATGGAGGGGGAACTGGAGGTCGGGTTGTGTGGATAAAGGTAGTGGAGGTGGATATTCATGATGGAAGATCGATGGGGAGTGGGTTGGCCTGGCTGGACCCGGTTCGGAGGGTGGAGATCTACTTTGGGTGTGCATGCAGCTTAAAATATAGACTTCTATCTAGAACCAACAGGAAAGTTCAGGCTTGCCATTCAAAGCCATTATACCTTTTATCTAATCCTAGGAGAAGCTGCTACAAGGGTACATGGTGCGATCCAGAGTCCATCTTGACCGATTCTGAGACAGACCCCACACATTGCACTTCATATATAATAACTAGGACCGATTAGGTTTGTTCGATCTTATTTTAAATGCCAATGCCGACTGAGCCCGATATCGGTGCTGGCTCCCTAGACTACTGCAACTAACTGACCACACGTGGTTGGAAATGTTCATAACCATCCCTGTCCTGCACAATTCAGGAGTTTGTGAAAGTCTGCTTCCTGTACTTGCTGTAGTAGCCCGATTAAACATATTCCAATGCCAGGCCTAGGAGTAGTGCCTAGGAGTAGTGCCCAGTCACACCTTGCTTTGCACGAATTTTGCAAGTTGACCGTCTGCCCTGCGGCCGACTCCGCACCTCCATCGGCGCCCTCCGCGCTGCTTTTCATAGGTGCTCGGCAATCGGCAGTCGGTGCTTTCCGAATCGCTCTTGGCCCCAAAGATAGATGGGTCGGAGGGCTGTCCGTCTCCGTGCCTGAGTCCAATTGACTAAAGTGGCTTCTGCGAGGCTGGATTGCAGACGTTCAACCCTCCTCGTCGTCGACCTCCTCCATCATGACCTGATGCGGTGCCCTGTTCATCTGCTCTGATGCCGCATTTTCCGTCTCTCCCGAGGCAACTCCCGTCTGGGAAGGCCCTGCACCCGTAGCCTTAAGATAGCCCTCCTGCTCGAGCCGGTCGGCCTCCTCGGGCTCCAGCAGCGCGCCGCTTTCGCCTTTGCCCTTGGATAGCTTAGCCTGCACGACCGAAGGCACAAAGGCGCTGACTGCCTCCTTCCTCAAGTCCCTCACGACAGGCTTAGACTCGTAGACCACCTTGGGCTCTGTAGTAGCCACCGGTGCAGGCTTTGGCGGCAGAGCCGTGTCGCTGTTGGAGCCTCGGCCCAACCCCCTATCTTTCGTCAGCGGCACCGCATTCGCACTGCTTCCAGCGCCCGCACTGGCATCCGCACTCGCATTATTGCCATTGTTGTTGTTGCCGCCACTACGCTTCGCCCTCCTCTTTGCCCACCACTTATCCAGAACCTCCTTCGGGATGGGCGGCGGCGTGTCCCGCGGCATCGGGATCCTGGCGACGTCCTCGGGAACCTCGTCACTATCGCTGTCGCTATCCCTTCGCAGCGCGCCATCATCGCCCCTTCTCCTCTTGCCCAGCGAGCCCCTGTCGTCCCTGCCACCGTCGCGGTGCGGCCGACCGCTGCCAAACTGCGGCGCCTTGTCCCCGAGCAGCTCGCGCGCCTTGAGCACGGCCTTGAGCTCCTTCTCCAGCCCCTCGAGGACCGACTCCTCGTGCGACGAGAGCTTGCCGCCGCCCTCGGCCACCGCCTTGAGGTCGTCGATCTGCCGCTTGATCCCTTCTGGGTTGCGCTTGGCGAGGCGGTCGTTGCGGCGGGCTTGGACCTCGGCCTTGCCTTTTTTTTCGGGTGTAGAGGTTAGCTTCTGGGCTTGCAGCAATCAAGGTCAATGGTTTCTGGGTCTAAACCGCTTACCTTTTTTTATCTCCCTCGCCTTGTCGGCTTTACGCTGCGCCTGCACGGGGTTGTAATTTTTCTCTTTGGGCATCTTCGACTACTTGATTCACTCGATATGGGTGATTGTTTAGTAATTTAGAAGAAGTATAGACTAGCAACTCGGGTAAGATGGGTTGTAACAAGTCTGCAGAGAATTGGGCAGAAGCATCAAATTGCGGACCGCGACGCGCTGGAAAGGCGCTAGATGGCGATGACGACGGGCGGATAGTGGGTCCACTCCCCCTGAAGCCGGATTTTTTTATCTTATCTGCAGGCGGACATGGGTATCGTCGGCACTCGAAGTGTAGTCGCGGGCGCTTGCATGGGCGAGGGGCTCTGAGGCATGGGATAAATTAAATATGCATTTTCAAATACTACCAACGCCATTGCGATGGCTTCTCTTCGAAACTTGGATAAATGAAATCAGGCGAGCTTATTATCTGGTTCCCACGTAATTAGATGATCACATGAGTATTTACAGCAACAGAAGCAGTTTTACATGCCTTGAGAATGTTCTTGTGGCAAGTCAATAAATAGAATTTGAATAAAAAAGGCCTCTAGTTACCCATGTCACACCACCATTCAGTCGTATATACCGTTTACACCAAGCAAATATTACAAGTCCTTCTTCTCCCCGGCGCCGTTCTGCGCCTGGCTAGCACCAGCCTTCCCAAACCCAGGGGGCGACTTGAGCCCCATAAAGACACCAGCGCTGACGCCCGCGATGCCCAGCGCACCGATCGTGTAGGCCGTCTCACGCCCGGCCCACCAGTAGATGCTCGTGAAGAGAACAGGCCCCAACCCCCTGCCGAGCTGGCCCCAGCTGCGCAGGTTGCCCAGCTTGCCGCCGCGCTCCGCCTCGCCGGCCTCGAGGCTGCTGAGCGTGTTGAGGCCCGTCACGACGGTCGCTGAGGTCGTGGCCAGGCATGTTGCGGCAACGTAGAGCGCCGCCACGGACGACGCGCGGCTGAGGATTCCAAAGGCCAGCAGGCAGGCCACGACGCCGACGCGGACAGTCATGAGGGGCGGCAGGCGCCGCGTGACACCGCCCTGCAGTATCGAGGCCACCAGGCCGATGTAGCCGAGCAGGCGCCCGTTCTTAGCCGAGGTGTAGCCGAAGAGATCGTACGTCATGAAGGGCAGCGAGAACTCCATGCCCGAGAAGAATAGCAGGAAGAAGAGGTGCGTGGCGTTCAGCATAAAGTGCGAGTTGGTCCTGACGGCGCTCTTGGGCTTGGTGGTAGTGTCGTTACCCTTGGCGCTCGCACTCTTCTTGGTCTCGGTGAGAGCCGGCAGAGTCTCGGGAAGCGCAGCATACAGGTATATCGTCTCGGCCACAATCAGGAAGAGCGAGAAGCCAGCAGCGGTCGCAAACGGGTTCGCTGCCACCAAGGGGATGGAGCTGAGGTATGCGCCGAGCGCGGGGCCGAACGTAAAAGCGATGGAGAAGCAGGCCCCGATGAGGGCCATCGTAGAGCCTCGGCTGCTCTCGTCGGAGATGTCGGTAGCGATGGCGGTCGCGAGCTGCACGTTGCCTTCTGACAGACCGCCGACGACTCGCGACAGGACAAAGGTGCGGAAGTCGACTGCCATGACCCAGAGCAGCACGGAAAGAATGTTGCCCATCATACTGGAGAGAAGTGCGGTTCGGCGGCCGTAGCGGTCCGAGAGTTGACCGATAATAGGGGATGCGATAGCTTGGAGCAGGCTGAAAAGGCAATGAATGGTTGGGCTGTTGTTAGCTTCGGAACGGTGCGATTGTCCCTTTCCCAGCTCCTCCCGGGCACCTACGAGAACAAGCTCCCCAGAGCTCCACCAAGCAGTACAATGTCATATCGGGAGTCGATGGGGCGCGCAAAGGCGGCTTTGTAGGCGTTGAGGTAGTCCAAGACGTTCGACAGTAGGGTACGGGGCCGCTTGTCTAGCAAGCCAGTGGGCGCCTCGCTATTTCGGTAGAACTCGAGCAGCTTCGGGAACAGTGGAAGGATAAAGGTGAATGATATCTATGCGCAGGTGAGATGCGCGCTTCTGTCAGCGCCCACATTCTCCTACACCATGCTGCAAAGTAGCTTGCCAACAAAGCTTGCGGCTTTTTTCTTAACTCACCAGATCCAGCAGCAGGGAGATGAATATCACCCTGAGGACCCTTTTGCGGGCGGCGGCGTCAACAACCGCCATCTTTCGGTTTATGGGATAGCGACCTGCGCTCTTGCTAGGATCGAGTACCCTGGTGCGGAACAAGGCTTGCCCGAATGACGTGGTACCTGTAGCTCAAGACAAGAACTACAGAGCGCGCAAACGAAAGACACGAAAAAAAAAGGTGGGGAGGGCGAAAGAGATACTGGTTGTTTCTAACGCAAACCTTCCAGCTTTCGAAGAAAAGAATGCAATCAAGCGACAACAGATGAGAGAAAATAAAAGGAAGGAAATGAGTTAACCTTGTGAAACCAACTCTTGGGAGCGAAGAATCTACATTACGAAAAAAATATGCATGCGTGGTCAGATCTCCATTGCGCTCAAGTTCCGATCATCCCATCCGTGGTGGAATCCCACCTTGGGGGGTGCTTCACATCCCTGTCTGAGATCCAGTAGTGACCAAGCTGTGGGTGCTGGAAAGGTCCGAAAGCCATAAAAACGGACTAAGGCTGGGGCCCGGGATCCCGGGGGCGTTGTGCTGCAACTGGGCTTTCCGCCCCGCTACCCGCCCGCTTTTGTGGTTCGTTTGAGGTGCCTGAGCGGGCTTGAAGCCTGTGCACTGCAGTTAAATTGAATTAATTGATGAGATGAAGACGACGCGACATAAAGCTGGATCAATTCCGATAGTTTATTTTCTGCTACCTACCTCGTTACTTACCTTACCCAAGTCTATAATTGAACTGCCTTGACCTTAACACAACCCTATTATCTTCTCGCTTCTATCCCTACCTCACAGGACCCCTTCTGACTATGCAAAAGATGGTGGGTGGCAGGGTTACTACTATATGTGCTTGCGTTTCTGTTGGTTGCCTATCAACTTTCTCAAGCCGCTCGGACAGCATCACAAGACCCTCTCTGCGGCTTTGCAAAGGGATTAAATACCGATCAAAACTCCTGTCATGTTACCATTAAGATTTTTATCTTATCGTTTCACCCACTTGCAGTTCATTGTAGGTTGCTCGAGGTTTCGGCCGAGACCAATCCACCACTCACTCAACCTACAGTCTTGCCAAAGACGGAGAGAAGCTCCGTCACATCTCGGACACAGAAAGGCCGTCTAACCAAATTGACTGAAACCAAGAACGAGAGAACACCTTTACATAACCGCGGTGCATCGGCCCGTTGCTCAGGACCTTCGCTGCTCTGAAAACACTTGTCCAACTTGGTGCAAGGAGAGGATACTTCTTATCCCATTACTCCCCCAATGCTCGTGATTTTGTCCTGTTACTCTGTATCTATTTACGCTATGGTGTCTTAGGGTCGCCCTGATTTGTTACCCAAAAATTACTGCGCACTTTCCCTCACTGGGCTACTATGTTTTCTTGAACAACCCCTCCCCCCCCCCCGCCCTAGGAGTTTCCATATGGAGGGCGCCGCGCCACGGGTAGTGATATTCAGAGTTGGAATTGACACTCAATAGTGCATTGATATACATATATGCATTTAGCTAATGCGCGCCTGCACCAAAAAATGGGCGCAAGGTAAACCCAGCAATTGAACAGTAGTATTCAGAGATCCGGCCAAGCAACTGGAACGAAGCCCGTTTCAATAGTAATACGTAGCAAATTAGGCAAACAGAGCGTATGTACCCGCGCGATAAACTTGCTGAACTCTGTCGACGGCGTCTTGGCTGGCGGGTTGAGAATGTTTGTGCATCCCAGCCTTGTCGTTTATGGCCCGCCGCCCTATGAGCGTGGGTGGCGGGGTTGCTGCATCTGGGATCTTGTAGGCTTTTTTGAGCTGAAGAAAGCCATTTTGGTAAACAAAAAAAAGTTCTCTCGCGGTTCCAACGCGCCGACTACTTGTCTGCGTTGCCACTCTGTAAAAGTGTCTTTAACAATAACACGATTTGTGTTTGGGAATGGTGACGAACAATAATCGGGGTGGGATTGTAAGTACAAGAAGTTTAACCGTTATTTTAATTCTGAATACTTACCTCCTTGATATTCTGGCAACATTCCCAAATATCACAACACAATAGCCTGCTTACAGTGCCCCTGATCTTGAGTATACCGGCACTACGGAAAGAAAACTACATCATATCTTAGCCAGAGTCCCTTGGAACTTCTATGTTTAGCAGAATCCACAGGTCATACATAGGTCAATTGCGTAAAATTCCAATGTGCATATTTCATGACCGCATCGCGCCGTGAGCGATACTCCAATCCGTTAAGCCGCTTCACGTATTTGGGGTTTGTGCAAATCCAGGGTCAGAAACCCAACTTGCATGCTTACATACAGGCATGATAAAAGCCCAGCATTATTGTCAATGCAAAGTCTATCATAGACCCTGGACCATTTCTGGAATATCTTGTCGTCTTCTTGCCAATATGGTTACCATATGTACCTTATTTTTCCGACATTCCTATATGCGGTGAATAAGAGTTCGTAATTTTCCTACAACTAAAAGTCCAACTGAACAGGCCCAGAGGCATATCCGTGCATCCACCCATGCTTGGCTTTCATCTCATCTAACGTTGCGTACCCCCTGTTCGGCACCCCCCCTGTTCGGCACCCAAAAATAACAACACTTTTATTTTTATCCTCCAACTTCTATTATAAATATCTCGATGAATCTGTCACTTTTGGATTTACTTTTTTCTGATTTTAATTCTCCATTTTCCAATGAAGCAATATACTGAAAAACAGCTTATATCTGCAATTAACGACGTCAATAATGGCAATCCAATTGCAAAAACCTCCCGAAAATGGGGAATACCTAGGTCTACACTTCAAAGTCGACTTAAAGGTTCTCAACCTTATAAAAAAGCACAAAGCCCTTTTCAAAGGCTTTCCACGGAACAGGAAAAGCATTTGGCTGATTGGGTACTTACCCAAACAGCTTTAGGGCTTCCGCCAACGCATCAAGAATTACGCTTTTTTGCCGAACGAATTCTTCAAGCCGCCGGAGAGACAAAAGGCCTTGGAAAACGTTGGATAACTCGTTTTTTGGCTCGTTATCCAATCCTTACAACCCAAAGGCCCCGTCGAATAGATAACGCCCGGGTTAATGGCGCTACTACGGAGGTAATTAAATCTTGGTGGCTTTATATTACGAACCCGGTTATTAACGCTATTAAACCGGAAAACCGTTGGAATATGGACGAAACCGGTATAATGGAAGGCAAAGGATCTAATGGCCTAGTATTAGGGCTTAACGGGATCCGGCCGTTGCAACGAAAAGAGCCCGGAACGCGTGGTTGGACGACTATAATCGAATGTATATCGGCTACGGGCGTTGCCCTCCCTCCCCTCGTTATATTTAAGGGAAAAAACGTACAACAACAATGGTTTCCCACGGATTTAAGCCCTTTCGATAATTGGCAATTTCATGCAACCGAAAACGGGTGGACAAATAACCAAACGGCTATCGAATGGTTAAAAAAGGTGTTTATTCCGTATACCCAACCTTTAACCCCTGAAAAGCGGTTATTAGTTTTGGATGGCCATGGATCACATATAACGGACGAATTTATGCTTCTTTGCTTGCAAAATAATATTCAACTCCTATATTTACCCCCTCATTCGTCACACGTTCTTCAACCATTGGATCTATCGGTTTTTGGGCCGTTAAAAGAAGCTTATCGACGTCAACTTGGATTTGTTAGCCAATTTTGCTGTTCAACAGTTATTGGAAAACGAAATTTCCTACTTTGTTATCGAAAGGCCAGATTAAAAGCATTTATAGCAAAAACCATTCAATCTGGTTGGCGTACAACGGGGTTATGGCCGGTAAACTTGGTTAAACCACTTTTAAGCCCTTTTTTGTTAGAAAATAGCAACGCCAACGTTATAAAAGATAAAAACAACGGTTTGCAAAGGGATAAAACACCGGAAAGCCCAGCCCAAAAAATTAACGACCCGTCTTTGACTTATTTGGAAAACCCCTAAAACGACCCGAGATATCCGACTTCAACTGCAAAAACTTTCCCAATCCAACAAAACCAACGCTACTTCACGTCTTTTATTTGCAAAAGTCCAAAAAAGCTTCGAAGCCAAAGATACCCTTTTGGCTAGCGCCCAGCAAAAAATCAGCTTATTGGAAGCACAACTGGAGGCAATACGGCCGGTTAAAAGGAGGAGGGTGGTTCCGGATCCAAACGAGCTTTTGGTTAACAAACAGAACATTATTGGATTGCAGGAAAATGATATAGAAAATTTGGAACCTTTAGCTGATGAAGAAGAGGTTAATGAACCGGAGAAGCGTGAAAACGATTGTATTTTTGTCCGTTGATAATTTTATATTTAAATCAGTTTATAAAAGTAGGCATTTCGTTGTTAGATTTTCAGGGTGCCGAACAGGGGGGGTGCCGAACAGGGGGTACGCAACGTTTTTTTTTTTCGGCACGAATTTCGTCTGTCATCCCATGGCCCCGGGCAAGTGCCTTGACTGCATGTAAAACTGTGTCTCATGGAGCCTAGCTACAGCAGTTCGTATGACGTACGGAGACGAAAAAAAAGAGGTCGCTATCTCGGCCCCGGTTAGTCGGGCCAAACCGAAGCCAGCAGGGTGGGAGAGTGTAGCACAACAGCATGGTACTATATGCAGGTGCTACAGTAATTAGTGTTGATAATCATTGCTATCGATTGGCATACCGGTATATATAAACACAACACTACAAAAAACAGCTCCACAGAATACTGATCAAGTAGGCGAGCGACGTAAAGCGAGTGAAGTGGAAGCCGAGTACGTAGGTACTTGGTTTTTGGATCTAGTCTGTCCACAAATCAACACGCACCGGTGGCAGTCCTCCGTGCTCCCCTGGATTTTTTATGTGGCCAATAAAGCCTCAACATACCAAGAGCTATCCATTATGAAGGCCGTGCTGCAAAAGCAAAATCTCCCATGTACAAATTGTGCCACACTACCTTGCCAAAGTTTCGATGTAAAGAGAATTTGGTGTGGGCGGGGCATCCGGGTGTATCTTGGCCACTGCCGCAGAGGATTACCTACAAAATACCACATTGAGCATTGTGGCACTGTTGTGGAAAAAAGGAAATATCAGCAGCAGCCAAGGTAGGCAGGTAGGTACCCGAGGCGACCACCATCAGCTTCTCAAGGCCTGGCTTGGCTAACTAGCGCAGGTACAAGCTGATCGGAACTACAACAATACTACCAGGACACCACCCATACCGGTAGACGATCTTGATACCCTCATTTTTTCCCTTCTTTCTTTTTCCCCTCTTATTATCTTTTGTTCTTGCATTTTTCTCTATCCTTCATTTCTCGCATCAACAACAAACATCATATCAAACGACTCGACTGCTGCCTGTTTATTGTCCGAAATTACGACCAAGACCAGCTGCTGCTTTGCCATTTTGTGCCCGCTGCTACAAGGTACCACCGAATCCTCTGGCCCATCTATGAGCCCGCCAGCATGCAGCAGACTGAGAAAAATTTCCGGTCTTCCTCTTGCGCCCCGCACGAATTGGGGTGGATGAAAGATAACGAAAAAAAAAAATAACAGAGGATGCAAGATGGTAGACGCTTGTCCCCTGATGACTGCCGATGCCTTGCCGCGTCCGTACGTCCATCTTAATTTGCCTTTATATATGTGGCTGATCGACCAGAGACAAGAAGCTACCGTTGCATCTCTCTCCCTTGCTGACAGAACTCGATCTTCCTTTTCCCACTTTGGATGTACTGTAGTGGATGGGCCGCGATCTGAGCTGCAAACTGCACAGTAGTATACAAGCATGTCTCGGCTGTGAACGGCTGGTGCTTGCATAGACATATTGCCTCATCGCTTTAGCCGTAACCAGAAAAGACAGGGCTCAGCCAGCCAATCCCTTCGCAAGCCTCTTACATGGGCTCCCGATGTGCTAATTCTGGTATTTCTACCCGGCGGCCACCACCATGGTCTGCGCCACAAACTGTCTGCACGTCTGGGGTCAGGTACCGATCCCACCCTCCCTTGTCATCATCATCCAACATCAGAGCGCGTTTATACCGTGTGTATACTGTCGTTGGCTGTGGTTGCTCGGCTCTCTCTCTCTGCCGTGTAGCCCTTAACAGGTGCTCCGACTTGGGTGGTGTGGGCGGCACATCGCTATAGCTTCTGCGAATCTAGACCAGAACTGGGGGTTTGCGACTGGGGGAGTGGGCTCGGCCTCGGACCCGGGGCAACTTGCCTGTTTTTTTTTGTAACGATACACCATGTACAAGAGGTTCCTCGACAGGATAGGAAAAGGGCGAGCTCCTCCTCCTCCTCCTCCTACATCCTCGTTCCCGGGCTCTCACTCGGCTTCCGCTTCACTCGCTCTACGTCGCTCGCTCTCTCCTACTTGTCATAATACTCATATCAGTATCAACCACAATAATTCCTCTTGAATATAACAACAACTGTCACTACCTGCCAACAAAAAAGTCTACGAAATACCCCTGGAAAAGATGAAGAACGTCACCTCTCTCGCCTTGCTGGCCATGGCCACTTTTGCGGTAGCCGACTATGATGTAAATCACCCTTCTTCTAATGCACCGTCTAAGCGTTCCTTCGGTTCCTCTTCCTATGGTGGTTTCCCAAACAAGGGCGGCAACCCTCCTATGCCCGACAAGCCCTACTCTTCCAAGTGCACCACGACCACGACCACCAGCACCACCAAGACCACCACAGTTCAACGCTCATCGTCAACTTTGTCCTGTTCCACCTCAGCCTCTTCTTCTTTTTCTACTCCGACCAAATCTACCTCCATGTCCACCTCCTGTTCTACTACCGCCTCTTCCTCTGTTTCTTCTTCCGCCTTTACATCAGTCTCTACCTCCGTTTCCAGCACCGCATCTACCACCGCATCAACCTCTGCCTCTTCCTCCACCTCATCTTCCGCTTATCCGGTTTCCTCGTCCTCTTCAGCCAAAACCACGACCACTCAGCTCTCCTCTACGTCATCGTCTTCTGCTTCTTCTTCTTCTTCTTTTTCTTCAGCCCAAACCAAGACTGTCGAAACCAAAACCATTAACCCTTCGTCTTCAAAGTCGCATAAGCCAAGCCAGCCGCCTCAGAGCTGGACCACCAGCACCTTGACCCTGACCTCGACCACGACCTTCCTCGAGTGCCCGACCGCGACTCCGGACTGCCCCATCAAAAAGCCCGCCACCACCACCGTCGTCGTCGTCACCACCACCGTGTGCCCCGTCACCAGCGCCACCCCGTCGCCCCCTCCGCCGCCGCCCAAGACCACAGCGGCTCCTCCTCCACTTCCTGCGGTCTCTTCGGAGCCACCCAAGACGACCGGAGCTCCTCCTCCCCCTCCCCCTCCCCCTCCTCCGCCGCCACCTCCTGCTTCCAGCGGATCTCCTGCTCCGCCGCCGCCGCCTCCTCCTCCTCCCAAGACCACCATGGTACCGCAGCCGCAGCCCCCTACCACCTCGACCACAACCTCTGCGCCGCCGATCGTCACCGCCGCCGCAAACGCTCAGCGTGCCGGTGGTGTCCTGGCCGCCGTTGCTCTGGCCGCCGCCTTGCTCTAAGCGAAGAGACTGCGAAGAGACTTTGTGGGGTAATTTGCGCGTTGGGCGCAGTGGCTGGGCTGGGATTTTGGAGTTACCTGAGGATCTTTAGTGTTGTTTCACAGAAATGAAAAGAGAGAGACTGGTGTGAAACGACAACGGAAAGAAAAAGTACCCCCTCCATGTCAACTGTTTGTCCCCCCCTCCTTCTACCTTTTTTCCCCTGAGTTTGTTTTCTGCTTTTTCCCCATCAGATAGATGTACTTTTTTGACCTGACGAGGAACTCTTTAATGGTATGCACATTTGAACTTTCTCCCATGATTCCATTTATCGTTGTCCAGCCGACCAAAAAAAAAGCTCTCCTGTTGAGATCCTCATTGTCATTGGCCTGAGAAGTGAAGATCTATATTGAAGAATAACCATAGTGTTCTTGAGACCAGCTCCGATGATGACATGCAGTATTTTCGACCCTTGCCATTATTATTGTTTTGAGACACAGCAACGAAGGAAACAAAGAGACGAGAGCGACGGTGGAAATTAGCTATGCATGTCTAGGACTGGTGTATATTCCAAGGGATGGGGGGAGGGGTTTAACAAGGGAGCAAAGCAAAACAAAGAAACAAAGAAGACGGTGTTTCAAACGAAATACGAGTATGAAATCGGAAGCAAAAGCAAAAAAGAAAACAAAAGCAATCATGCCTTTCCAGGATCAGCATTTCCAAGACCCCGCTCGGACCGTTTTCTTTTTCTATAGTACACCATCAGAACCGACGACGCCCAACGAGACCATGAAGCCGGTTGATGCAAGAGGGATTGCGTCGATCCATAAGAACCTTGACCCCTCGGATGCAAGCCTACGCAAAGCTGCAACCCCTGCCTGCACATCACCCCCAAGGCGCAATTACATTATGAGCTGTTCTAGGCCTAGTATGCTCGCATCCAGTTTACGTCCACTAGCCTCGTATGTTGCAGGATCAAGAGAATAAAAGAAACATGAAAATGCCGAACGAGAATATATCACGTAAAGAGAGATATTGTGCTTGTTTACGCGTCAGAAACGTCACATGAATGGAGAAAAGAACTCAAGATCGCGATTTGTGACCGACACGTGCCTTTGAACGGATGTTATTTCTCTTCCATGTGCTACCCAGATTTATCTCTCTGTCTGACCCCTTTCAAAGTCTCCCATGATGTTTTTCTTTCCGGGTCACCCATTGTGGCATGCCACTCTCAGATATCTGTGGGCGCCCCCGGAGGCCAAAACCTGAGTCATTTCGAGGGAGGACAACAGCATAGTACTCGGCGCGGCCGTGAGCTGACGTTTTGGGGTTGCACCCGTACACAAAACACGCCATCCACCCAGCCCGCTGTGGGGGATTTTGGTGGTAGTGCATTGCATCTGCCGGTAGGCTGGGGCCGAGGCGAAGATAGCGTGCGAGGCTCGCCCAGATCCTTGGGTTACTAGGAAATGGAGTTGCTGGCTCTTCATTTTGTCTTGTAGTGCGGCATGGTGACAGCCGGGCCAATTAAGCTTTGCTTCGTGCGCCAAACACGCCTGTAAAGGAAACGAAAACAGGTTTTGAGCATGTTCGCCACTTGTCACAAAGGTGCCCTGTTTTCCTTGGTTGTCATGCACTCGCTTGTAGCCCAACCATAACATGGTTCTATCTATCAGTGGGGTGATATATTGTATGGTCGGAGTTCGCCTCATGTTAGCAATTATTGTGTTGCACAACTAAACCGGGCCGAGCATGAAGCGATATGAATGATGGAGTCGTCATAGGCCGGAGCGGGGCCTGGCTCAGGCTCGTCGTTGGTAGACTGACTTTTGGCAGCCGTGTACTGCCCGTGACCGCCCTGGCACCCTGGGATAGCATTTTAACCGGCCACTGACCGTTGTGAGCGCCTTGTAAGCAGCAAGCGTTGGAAATTCAGTGTATGGATGCTGAACGAACGCGAACCACTGCTGCCCAGCATAGTCTGTGGGCCTCTGCCCTGACTATCCTCTCGGCGACGTAGAAACAACGCTGGATGCAAGCCTCTAGGTACCACCAAGTGGCCCGCGCAGCTTGGTAACGACGTCCTCGATCCTCGCACAATCGCCAAAGACGTCTTGCTGAGTGACGCGATCGCGACCTCCGTCTGGCAGAACCACAACCGACTGAAGCACCTCGCCACCGGGGCCGATGACGAGCCGTCCGACGCGACCGTCGCGCCAATCGAACCTGAACTGCGTCGCTGCCGTGTCGACCGGCTCAATGTCCACGATGCCAGCCACCGCCCGCCGCTGCCTCGCCCTAGACTCACGATCGTCTTCTATCGACTTCATGACGACGGCCTCTGGCGGCTCATCTGCCGGGGTGCCGACAGGAGCCTTGGACCTGTCGTCCAAGCCAACAACAGCGCGTAGGTCGGCAACAGCGCCGAGACGTTGGTGGTAGCGCACAAGCTCCCTCCTCAGCCGACGGACGAAGGCCCCCAGGTCCTGCCTGGGCC
CCTCGTCTTCAGCATTACGTCACAGTCATCACTCGCAGAGCTAGCACAGCTGCGGGAGGAGATTATTAGGATAAAAGACGACGAAAAAGTGCCAATAGTC
ATATGCGGCAACAAGGCAGATCTGGAGGAGCAGCGAGCCGTCCCCCGAACCAAGGCGTTTGCCATTTCACAAAGGTGGGGAGCGCCGTATTATGAGGCGA
GTGCCAGGACAAGGAGTGAGTAGGCCCATCCAGATCTTATGCCGGGTCAAAATGTCCCACATGTGAACCCTCAACTCAAATCATGTGTTGCGCTGACTGG
GCACATCGCGATGAAGCAAACGTGGACGAGGTCTTTGTTGATCTATGCCGGCAAATGCTTCGACGGGACCAATCCTCACCACACGATTCGTTCCAAGACG
GTGACGAGCGTACCGACGGATCCGGGGGCTTCGGCTCCAAAAAAAACGCAAAGAAGCATGGAAGGCGCACGCGGTGCGTCATACTGTGACCAAGTCCTTT
TTCTCGACTTGACCTGTTTTATGCGGTTTCTCTATCGACACGTTTTCGATGAAAATGACTCTTTTTCGTACACCTTTCGAGCCTTTCTACCACCTACCTA
CCACATACCTTACCTATCTTGCTTTTTTAAATCAGTTTCTCTAAGAAAAAGGCGAGATTGCAAACGAGGAGAGCGCAAGCTCCAGAATTGTTTTTCATTT
TTATATATATTCCCCCCAAATTGTTTTTTGTTTCTTTGGATGGCTTTGGCATTTGTTTGGCATATGGATCTTTTATGGTTATTCCTTTTGTGGAAATGGG
ACAGGCGCTGGTTACCATGATCATCTTTTCCTTTTTATTCTTTATGTTTCCCATTTATGGCTAAACAAACCGCGTTGGACTATCTGTCTTCTTTATATCT
TGGGCAGTTTACAATATTGACACCGTCACCATGATCAGAGACGTTCTCTGTTCCATCATCGGGCAAAAAGCCTTCCATATCTCGACTCCTGGATGATGAT
AATGAACCATACTTGAGCCGGGACAATGAGCGGCTTGGTGACACGCTCAATCACACCAAGGTGGGCAATATCAAAGTGTTTTTCTGGCATAAAAACTATC
AAGATATATACTAACGGTTGTATTGTATTTCTTCTATTTGCATCGATAAGCCTGCTTCAGATAGCTAAGGTACCTGGGTAGGTACACCTACCCTGTATCA
GCTCTGCTGCAACGACCGAAAATCGGAGCATCGTAGCTCCAATGCCCCTCCACCCGTATACGCACATATCCGGGGTGCATGTTCTCAAGACCTGCCTTAG
TTAATGTCTATACTGGCAGCAATCTTGCTATTCGTACCTCATTTTTCTCATTCCTGGCAACTTGCCATTGGGATTGAAGCCGAGATCGATGGGCGTTATA
ACTATACATCAATCCTCTACCGCGCATGCTGCAATCACTAATCCCGACCCCCTTGCCTCAACAGCAACATCTCTCACTTACAGTGGTTTTCACGGCGTGC
CGGTCACCATGCGGCTTCGAAAGACTGCCGTTCGTTTCCAGCCCATCGTTGTTTTCAAAACAGGCCTCCTGCTCCTCGCCCACACCATCACAGCGACCGC
CTTTGGACTCGAGAAACACCTGGATGTCCGATCAGCGTCGATATCCTCCCTCCACGACGCCCTATTCTCGGGCCAGACGACATGTCGCACCATAATATCG
GCACACATCTCCCGAATACAGGCCTTCAACCCGATCATCAACGCCATCACGGCCCTGGATCCGGCCTGCCTGAGCGCAGCCGACGCCCTCGACGCCCAGC
TGGCGGCGGGCAACGTCACGGGCCGGCCGCTGTTCTGCATCCCCGTCCTGCTCAAGGACAGCTTCGACGCCGCGGGCATGAGCACGGCGGCGGGCTGCCT
CGCTCTGGCGCGCAACCGGCCGCGTGTTGACTCGCCCACCGTCGCGGCCCTGCGAAGCGCCGGCGCCGTCGTCCTCGGTAGGGCCAGTATGCACGAGCTC
GCGCTCGAGGGAATATCGGCGTCGTCGCTCGCTGGCCAGGTCCGTAACCCATATGACCTGCGTCGGACACCGGGGGGAAGCTCTGGTGGGTCCGGGGCGG
CGGTCGCGGCTGGGTTCGCTGTGCTCGCTACGGGGACAGATACCGTCAACAGTTTGAGAAGTCCTGCGAGCGCGAATGGGCTGTGCAGCTTTCGGCCCAC
GACTGGACTGGTGTCCAAGGAGGGCATCGTGCCCGTCTCAGCTACGCAGGACGCCATCGGGGCGATGGGGAGGAGTGTAGAGGATATCGCTGTTGCGTTG
CAGGTGATGGCTGGGGCGAGGGGGGAGGATGTGCCGGACGAGGTTGTGGGGACTCATTACGTGAAGGAGATGATGGAAGGGGACGGACTGAAGGGATTGA
GGCTGGGTGTTGTGGATGGCTTCTTCAACCATACCGCCGACCCCGAGACAGACCCTGTAAACAACGCCATGGAGACTATGATGTCGCTTCTCAAGAATGC
CGGCGTGACTATAGTCAACATCACAGACCCGGTTTTCGACGCAGTCTCCATTCTCACCAGCCTCGACGTGCAACGCTTCGAGTACAAGGAACAGTTGGGC
CTGTACCTCGGCCGAACCGATCTGGACGGAGAAGATGTGCCTCGGTCCTTTGATCAGCTATACCACGGCAACAGAGAAAGCCAAGACTTTGTGGTCCTGC
CCTACCAATACGACTTTATCAACAAATCCTCGACAGCCTCCACCTCGGACGATGAATACAAAACCCGCCAGGCAGGCATCCGCAGGCTCACTGAGCATCT
GGCCGCGACGCTTGCGACGCACTCGCTCGAAGCGCTCATCTACCCGCAGCAGAAGAACCTCGTAGTCGAGATCGGGTCGCCCTCCCAGGCCGGCAGGAAC
GGGATCCTGGCCGCGCTGACGGGATCTCCAGTCGTCGTGGTGCCTGCGGGATACTCGCCGGAGGAGGGTGGTCGTGGTGGAGTGCCGATCGGGATGGAGA
TACTCGGGATGTCGTGGACCGAGGGCCGGCTTTTGGGGATCGCTCGTAGCATATCGCAGCTGCCTGGAGCGCCGGCTTGGAGGATGCCCGGGACGGTGAA
TTCGAGCGTCGAGGTTCGGGCGTATGAAGAGGTGCCTGTTATTGTGCCTGATAGGGGCAGTGTCCCGCCAGAGTATCCGCTTGGCAACTTGTGGCACGGG
CCCGTGTGAGTTGATAGCAACTGCTTGTGCGCTAGGGAGTTTCTGAGGTATTTTGAGTAGAACCAGGCTTTAGTTATAACGAATTAGATATATACATATC
TATACCTCAAGCTCATAGCAGATATATCCTCGGTCAAATAGAGCAAGACATGTACCAGCACCCAGGACACCTAGTTCTAGATGTCCTTCACGGTGTACTT
TGCAAGTAATTTTTTTTCTTCTCTCTCTCTCGCTATCATCCAACGTCTATGGAGCAATGCTCTTAATGTGCCTGGTATGCAACTCATCAACAGCAGGGAT
GATCAAACTCTCTATCTCCATCTCGGGTTCACCCTCGGGCAGACTAGCTGGATCCAGGGGCATTTCGGCCACTCGCATCTTGGCCTCGGCGGCGCCGACC
ATGTCCTCTCTGCCGCTGACGGAGCCCCTCCTCCTGCCGGTGGGCACGCGGATCCAGCGATCGGCGGCGCCGGGGGCGACAAAGACGACCTCCCACTTGC
GGGTGGAGAGGAGGTTGCCGATGACGAGGTGATGCTGGTAGCGGTCGAGCGAGTAGCGGGCCTTGTGTACTAGGATGGCCGGGTCCGTCTCGAGCTTGAA
CGAGACGATCATGCCCTGCGGCGCCCAGCCGTCGACCAGGTTCTTGAGGAACTTGGGTACCGGATCCAGGTCTACAATCAGGCGCTTGGAGCGCGGCACG
GCGGGTGACGAGTCAAAGTTGTCAAACGTCTCGTCGTCGGCGGCGGCCTGCTCCTTGGCGACGGCCGTGTTGAGCTCCTCGGCGCTGAGGGTGGTGGGCT
GCTGGAGGGGCTGCTCGCCCGGAGGGATGGGAACGATGGGGAGGGCGCCCAACGGAGGCGCCGCCTGCGCCTGCGGCTTTCGCTCCGTGCTGCTACTGCT
GTGCTTCATCCTCTCCACGGCCGTGGTGGACTGGATCTTGTGCTCGGCCATGCGCTCCGGCGGGACGAAGAAGTCCGACACGGCCGCGGCGAGGTACAGC
AGACCCCTGGGTCCGAGCGGGCGCATCAGCTGCGCGACGGCCCTGAGCTCGTACAGGTAGTCGGTGATGGTGACAAAGGGCAGCATGAGCAGCATGTTGC
CCTGCTTGGCGGCGCGGTACTTGCGCAGGACGCCGAGCATCTTCTCAGCGCGGCCCGGCTCCGCCACGACGGCGCCGTTCTCCTCGTGCAGGAAGTCGAG
GAAGCAGTCGGTCGGTGTGTGGCTGTAGTGGCGCGAGTAGGGCAGCAGTGAGAACTGACGGTGCAGGAAGATTACTGCGTAGCCGGCCTCGAGGAAGTAC
TCGGCCGAGGTGGCACCGCGGGTCCCGGCGCTGAAATTGTCAATGAAGCGCACCGTCTGGCGCTCCAGGGGCACTGTCGTCCCGCCAGAAGTCACCAGCA
CCACTCGGCGGTTGGCGGCGGCGTGCTGCTCGATGAAAGCCGAGGCTAGCGCCACATGCTCCGACAGACCCCGCGGCGGCGGGTTGCTGCTGAAGTAGTG
GTCCTCCTCGGCCGCTGCGGAGGGTTCTGCACCAGCCGGTTTAGGCGGTTGTGGTACGTTGGACATGGCTGCAATGACTGGTTATAGGTCGATGCAGGGA
GCGTACAAGACTACACTTAATTTTGTGAAAGGGGCTGGCTTTCTGGGGGGTTTATTGGGGGAAATGAACCATTAATTGCGACGGTCTATGGTCTGATGTC
AAACCCAAAAATAAGCAATAGCGGGTCGAATGATTTGTTTCTTCAATTGAGCAAAAAATGATGCAGTGGCGATTGGATTGATCAACTGCTGGATAGTACC
TGTCACTTGTCAATTCCGCCCTTTGTGCTTGGTACCTATTATTGCACATTCAATTGAGCAGTGGGATCGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAGCGATACCCTTCAACCGCTTGGTACGGGGTATTTTTTATTCATACCAGGTTTGACGTAGACTGATAATTAATTCCCTTTGTTTGGCAAGATT
CAATTGATATCTGGATTGTTGAATAAAATCGCTCATAATATCTATCCCAAAGAAGAAAAAAGACAAATGACACAGAAGAGCTGTTGAGTTTGTTTTCTCA
TCTGGTTTCTTTTGTCCTCCGAAAACGCCTATAAAATGCCTGCAAGATGCCTGTAATATATGCCTGCAATACACCAGAACTGACCGCCAAAAAAAGAAAG
AAAAATTCCACTACAGCTCACAAGCCAAACCATGTTTACTACCCCTCCTTCAAATCAAAAGAAAACCCAAGGCTTCCACCCTACAGAATAAACCTTTGCC
GACACGAAAAACACTAGCGACAGCAGATACAACAGGCCCGTAAACACAATCAAGCCCCAGTAGTCGCCGCCGCACGCGGCCAGGATATTGCCGCCGATCG
GGATGCCGACCAGGCAGGCAAACGACACGAGTGTGTAAGCCGTGGCGTAGTAGCGGCCGTAGTTTTGCGTCTTGCACAGCCGCCCGATGCAGAGCGGCGT
GAGGCTGATGTTGGTCCCGCTCGCGAACCCAAACAGGATCGCAAAGACGACGATGCCCGCCGTCGTCCCGCCCGCCGGCAGCCAGATGGCCAGGCAGGCG
ATGAGTGACTGCAGGATGGCGATGATGTTTGCGTTGGCGGGACCGATGATGTCTGCCCACCAGCCCGGCAGCGCCCGGCCCAGCACCGAAGCCGCGTTTA
GCACGGTCAGGATCTGGAACGAAAACGCCGCCGAGAAGCCCTGCGCCTTTGCGTACAGTGATATGTAGCCCAGCGGGATGAAGAGCGCAAACTCCATGAG
GAAGATGCCTGCCGTCGTCAGCGAAAAGGCGACGTTGCGGAAGATGCGCGGGTCCGGGTGTGCGCTGGCGTTCTTGGCCGGTGGCAGCCGGGATCGGATC
AGGAAGTTGGCCGCAACTGCCAGCGCGATGCTCACGAAACCGAGCACTCGCACCGCCCATGCCCAGCCCACCCTCTCGAAGAGGTCCGACAGCAGAAGTG
GGAACACGACACCGCCGACGCCGCCGCCTGTGGAGGCGATGCCCGTTGCCAGGCCCCGGCGGTCACGGAACCAATGGCCTATGGCGGTGATGGCGGGCGT
GAACATGAAGGCGGTTCCCAGGCCATCAATCAGGCCGAAGGCGATGACAAAGTGCCAAAATTCTGTATGATTAGCATCTGGTCAGCTGACAGTCCATCAA
GCAGAGCAGAAAATGGTGGTAGTGTCGGAAGCAACCTGGCCTGGTACCAGTTCAAACTTACCGGTGCATATGCTGAGTATCATGGTGCCCACAGCCAGCA
ACACAGTTCCGAGTAATATCAGCCACCGCGGCCCATATTTATCGAATATAGGACCAATGTAAAGCCCCATCCCAAAGGACAAAAAGGTATATATCGAAAA
GATCCAACCGACGGTGCCCTCAGAGTAGCTGGATAGTTGATTTTGCGCAACATATGACTGCAGCACTCCAATGGTGTTCATAAGACCCAGTGATGACACG
AGCGCCATCCAAGATCCAAGGACAACGAGCCAAGCGCGCAGTCCGCCTTCAGGGTACGTCTCCTCCTCTTCATCCTCCTCGTCTGGGTCATCGCCCCTGT
TGGGAGCATCGTCATCTTTCCCGGAACCGGCGCCGGCTTTCTTGCTAGCCGCCTCGACAGCCGGGTCCCTGCTGGCAACGACGAACAGCTCCGGGTTCAA
GTTTGGCTGTGGGTAGTCTTGTCCAGCCTTTTCCGAGTGTGATGTGGGTGCGTGTTCTGGTGCTGCTGAATTCGTAGCGCTAGCCTGAACGGCATCACCG
CTACCCGTGTTCGTCTCAACCATGGCCGTCCTTACTACAGCCTGTCGTCCAAAAGACATGAGAACAAATTTATGCTACTGACTCTCATGAGCAACCATTG
ACTAGATCAAGAAAGGTCGCACAAGTCAATGCCATATATACAATGGTAAAAGCCCGTTTATTGTGTATAATACTCCTCACGAGTACACCCTCATGCAATG
GTGTGAAAGCAAAAAACCACATTTTGGGCAAGTAGATTGGGGGATGTTAGTGGATAGGGTAATGTAATGTGCGGCAAAAACTACTAGGAATCCATGACTC
CTCATTTAGGTAATGAAATCGGCGCTCGGGAATAAAACTTTTTTTTTCTCCTCTAGCTAAGCGATGTAAGTCAGCTAGCTCGACCTTGCATGGAGGGGGA
ACTGGAGGTCGGGTTGTGTGGATAAAGGTAGTGGAGGTGGATATTCATGATGGAAGATCGATGGGGAGTGGGTTGGCCTGGCTGGACCCGGTTCGGAGGG
TGGAGATCTACTTTGGGTGTGCATGCAGCTTAAAATATAGACTTCTATCTAGAACCAACAGGAAAGTTCAGGCTTGCCATTCAAAGCCATTATACCTTTT
ATCTAATCCTAGGAGAAGCTGCTACAAGGGTACATGGTGCGATCCAGAGTCCATCTTGACCGATTCTGAGACAGACCCCACACATTGCACTTCATATATA
ATAACTAGGACCGATTAGGTTTGTTCGATCTTATTTTAAATGCCAATGCCGACTGAGCCCGATATCGGTGCTGGCTCCCTAGACTACTGCAACTAACTGA
CCACACGTGGTTGGAAATGTTCATAACCATCCCTGTCCTGCACAATTCAGGAGTTTGTGAAAGTCTGCTTCCTGTACTTGCTGTAGTAGCCCGATTAAAC
ATATTCCAATGCCAGGCCTAGGAGTAGTGCCTAGGAGTAGTGCCCAGTCACACCTTGCTTTGCACGAATTTTGCAAGTTGACCGTCTGCCCTGCGGCCGA
CTCCGCACCTCCATCGGCGCCCTCCGCGCTGCTTTTCATAGGTGCTCGGCAATCGGCAGTCGGTGCTTTCCGAATCGCTCTTGGCCCCAAAGATAGATGG
GTCGGAGGGCTGTCCGTCTCCGTGCCTGAGTCCAATTGACTAAAGTGGCTTCTGCGAGGCTGGATTGCAGACGTTCAACCCTCCTCGTCGTCGACCTCCT
CCATCATGACCTGATGCGGTGCCCTGTTCATCTGCTCTGATGCCGCATTTTCCGTCTCTCCCGAGGCAACTCCCGTCTGGGAAGGCCCTGCACCCGTAGC
CTTAAGATAGCCCTCCTGCTCGAGCCGGTCGGCCTCCTCGGGCTCCAGCAGCGCGCCGCTTTCGCCTTTGCCCTTGGATAGCTTAGCCTGCACGACCGAA
GGCACAAAGGCGCTGACTGCCTCCTTCCTCAAGTCCCTCACGACAGGCTTAGACTCGTAGACCACCTTGGGCTCTGTAGTAGCCACCGGTGCAGGCTTTG
GCGGCAGAGCCGTGTCGCTGTTGGAGCCTCGGCCCAACCCCCTATCTTTCGTCAGCGGCACCGCATTCGCACTGCTTCCAGCGCCCGCACTGGCATCCGC
ACTCGCATTATTGCCATTGTTGTTGTTGCCGCCACTACGCTTCGCCCTCCTCTTTGCCCACCACTTATCCAGAACCTCCTTCGGGATGGGCGGCGGCGTG
TCCCGCGGCATCGGGATCCTGGCGACGTCCTCGGGAACCTCGTCACTATCGCTGTCGCTATCCCTTCGCAGCGCGCCATCATCGCCCCTTCTCCTCTTGC
CCAGCGAGCCCCTGTCGTCCCTGCCACCGTCGCGGTGCGGCCGACCGCTGCCAAACTGCGGCGCCTTGTCCCCGAGCAGCTCGCGCGCCTTGAGCACGGC
CTTGAGCTCCTTCTCCAGCCCCTCGAGGACCGACTCCTCGTGCGACGAGAGCTTGCCGCCGCCCTCGGCCACCGCCTTGAGGTCGTCGATCTGCCGCTTG
ATCCCTTCTGGGTTGCGCTTGGCGAGGCGGTCGTTGCGGCGGGCTTGGACCTCGGCCTTGCCTTTTTTTTCGGGTGTAGAGGTTAGCTTCTGGGCTTGCA
GCAATCAAGGTCAATGGTTTCTGGGTCTAAACCGCTTACCTTTTTTTATCTCCCTCGCCTTGTCGGCTTTACGCTGCGCCTGCACGGGGTTGTAATTTTT
CTCTTTGGGCATCTTCGACTACTTGATTCACTCGATATGGGTGATTGTTTAGTAATTTAGAAGAAGTATAGACTAGCAACTCGGGTAAGATGGGTTGTAA
CAAGTCTGCAGAGAATTGGGCAGAAGCATCAAATTGCGGACCGCGACGCGCTGGAAAGGCGCTAGATGGCGATGACGACGGGCGGATAGTGGGTCCACTC
CCCCTGAAGCCGGATTTTTTTATCTTATCTGCAGGCGGACATGGGTATCGTCGGCACTCGAAGTGTAGTCGCGGGCGCTTGCATGGGCGAGGGGCTCTGA
GGCATGGGATAAATTAAATATGCATTTTCAAATACTACCAACGCCATTGCGATGGCTTCTCTTCGAAACTTGGATAAATGAAATCAGGCGAGCTTATTAT
CTGGTTCCCACGTAATTAGATGATCACATGAGTATTTACAGCAACAGAAGCAGTTTTACATGCCTTGAGAATGTTCTTGTGGCAAGTCAATAAATAGAAT
TTGAATAAAAAAGGCCTCTAGTTACCCATGTCACACCACCATTCAGTCGTATATACCGTTTACACCAAGCAAATATTACAAGTCCTTCTTCTCCCCGGCG
CCGTTCTGCGCCTGGCTAGCACCAGCCTTCCCAAACCCAGGGGGCGACTTGAGCCCCATAAAGACACCAGCGCTGACGCCCGCGATGCCCAGCGCACCGA
TCGTGTAGGCCGTCTCACGCCCGGCCCACCAGTAGATGCTCGTGAAGAGAACAGGCCCCAACCCCCTGCCGAGCTGGCCCCAGCTGCGCAGGTTGCCCAG
CTTGCCGCCGCGCTCCGCCTCGCCGGCCTCGAGGCTGCTGAGCGTGTTGAGGCCCGTCACGACGGTCGCTGAGGTCGTGGCCAGGCATGTTGCGGCAACG
TAGAGCGCCGCCACGGACGACGCGCGGCTGAGGATTCCAAAGGCCAGCAGGCAGGCCACGACGCCGACGCGGACAGTCATGAGGGGCGGCAGGCGCCGCG
TGACACCGCCCTGCAGTATCGAGGCCACCAGGCCGATGTAGCCGAGCAGGCGCCCGTTCTTAGCCGAGGTGTAGCCGAAGAGATCGTACGTCATGAAGGG
CAGCGAGAACTCCATGCCCGAGAAGAATAGCAGGAAGAAGAGGTGCGTGGCGTTCAGCATAAAGTGCGAGTTGGTCCTGACGGCGCTCTTGGGCTTGGTG
GTAGTGTCGTTACCCTTGGCGCTCGCACTCTTCTTGGTCTCGGTGAGAGCCGGCAGAGTCTCGGGAAGCGCAGCATACAGGTATATCGTCTCGGCCACAA
TCAGGAAGAGCGAGAAGCCAGCAGCGGTCGCAAACGGGTTCGCTGCCACCAAGGGGATGGAGCTGAGGTATGCGCCGAGCGCGGGGCCGAACGTAAAAGC
GATGGAGAAGCAGGCCCCGATGAGGGCCATCGTAGAGCCTCGGCTGCTCTCGTCGGAGATGTCGGTAGCGATGGCGGTCGCGAGCTGCACGTTGCCTTCT
GACAGACCGCCGACGACTCGCGACAGGACAAAGGTGCGGAAGTCGACTGCCATGACCCAGAGCAGCACGGAAAGAATGTTGCCCATCATACTGGAGAGAA
GTGCGGTTCGGCGGCCGTAGCGGTCCGAGAGTTGACCGATAATAGGGGATGCGATAGCTTGGAGCAGG
CTGAAAAGGCAATGAATGGTTGGGCTGTTGTT
AGCTTCGGAACGGTGCGATTGTCCCTTTCCCAGCTCCTCCCGGGCACCTAC
GAGAACAAGCTCCCCAGAGCTCCACCAAGCAGTACAATGTCATATCGGG
AGTCGATGGGGCGCGCAAAGGCGGCTTTGTAGGCGTTGAGGTAGTCCAAGACGTTCGACAGTAGGGTACGGGGCCGCTTGTCTAGCAAGCCAGTGGGCGC
CTCGCTATTTCGGTAGAACTCGAGCAGCTTCGGGAACAGTGGAAGGATAAAGGTGAATGATAT
CTATGCGCAGGTGAGATGCGCGCTTCTGTCAGCGCCC
ACATTCTCCTACACCATGCTGCAAAGTAGCTTGCCAACAAAGCTTGCGGCTTTTTTCTTAACTCAC
CAGATCCAGCAGCAGGGAGATGAATATCACCCTG
AGGACCCTTTTGCGGGCGGCGGCGTCAACAACCGCCAT
CTTTCGGTTTATGGGATAGCGACCTGCGCTCTTGCTAGGATCGAGTACCCTGGTGCGGAACA
AGGCTTGCCCGAATGACGTGGTACCTGTAGCTCAAGACAAGAACTACAGAGCGCGCAAACGAAAGACACGAAAAAAAAAGGTGGGGAGGGCGAAAGAGAT
ACTGGTTGTTTCTAACGCAAACCTTCCAGCTTTCGAAGAAAAGAATGCAATCAAGCGACAACAGATGAGAGAAAATAAAAGGAAGGAAATGAGTTAACCT
TGTGAAACCAACTCTTGGGAGCGAAGAATCTACATTACGAAAAAAATATGCATGCGTGGTCAGATCTCCATTGCGCTCAAGTTCCGATCATCCCATCCGT
GGTGGAATCCCACCTTGGGGGGTGCTTCACATCCCTGTCTGAGATCCAGTAGTGACCAAGCTGTGGGTGCTGGAAAGGTCCGAAAGCCATAAAAACGGAC
TAAGGCTGGGGCCCGGGATCCCGGGGGCGTTGTGCTGCAACTGGGCTTTCCGCCCCGCTACCCGCCCGCTTTTGTGGTTCGTTTGAGGTGCCTGAGCGGG
CTTGAAGCCTGTGCACTGCAGTTAAATTGAATTAATTGATGAGATGAAGACGACGCGACATAAAGCTGGATCAATTCCGATAGTTTATTTTCTGCTACCT
ACCTCGTTACTTACCTTACCCAAGTCTATAATTGAACTGCCTTGACCTTAACACAACCCTATTATCTTCTCGCTTCTATCCCTACCTCACAGGACCCCTT
CTGACTATGCAAAAGATGGTGGGTGGCAGGGTTACTACTATATGTGCTTGCGTTTCTGTTGGTTGCCTATCAACTTTCTCAAGCCGCTCGGACAGCATCA
CAAGACCCTCTCTGCGGCTTTGCAAAGGGATTAAATACCGATCAAAACTCCTGTCATGTTACCATTAAGATTTTTATCTTATCGTTTCACCCACTTGCAG
TTCATTGTAGGTTGCTCGAGGTTTCGGCCGAGACCAATCCACCACTCACTCAACCTACAGTCTTGCCAAAGACGGAGAGAAGCTCCGTCACATCTCGGAC
ACAGAAAGGCCGTCTAACCAAATTGACTGAAACCAAGAACGAGAGAACACCTTTACATAACCGCGGTGCATCGGCCCGTTGCTCAGGACCTTCGCTGCTC
TGAAAACACTTGTCCAACTTGGTGCAAGGAGAGGATACTTCTTATCCCATTACTCCCCCAATGCTCGTGATTTTGTCCTGTTACTCTGTATCTATTTACG
CTATGGTGTCTTAGGGTCGCCCTGATTTGTTACCCAAAAATTACTGCGCACTTTCCCTCACTGGGCTACTATGTTTTCTTGAACAACCCCTCCCCCCCCC
CCGCCCTAGGAGTTTCCATATGGAGGGCGCCGCGCCACGGGTAGTGATATTCAGAGTTGGAATTGACACTCAATAGTGCATTGATATACATATATGCATT
TAGCTAATGCGCGCCTGCACCAAAAAATGGGCGCAAGGTAAACCCAGCAATTGAACAGTAGTATTCAGAGATCCGGCCAAGCAACTGGAACGAAGCCCGT
TTCAATAGTAATACGTAGCAAATTAGGCAAACAGAGCGTATGTACCCGCGCGATAAACTTGCTGAACTCTGTCGACGGCGTCTTGGCTGGCGGGTTGAGA
ATGTTTGTGCATCCCAGCCTTGTCGTTTATGGCCCGCCGCCCTATGAGCGTGGGTGGCGGGGTTGCTGCATCTGGGATCTTGTAGGCTTTTTTGAGCTGA
AGAAAGCCATTTTGGTAAACAAAAAAAAGTTCTCTCGCGGTTCCAACGCGCCGACTACTTGTCTGCGTTGCCACTCTGTAAAAGTGTCTTTAACAATAAC
ACGATTTGTGTTTGGGAATGGTGACGAACAATAATCGGGGTGGGATTGTAAGTACAAGAAGTTTAACCGTTATTTTAATTCTGAATACTTACCTCCTTGA
TATTCTGGCAACATTCCCAAATATCACAACACAATAGCCTGCTTACAGTGCCCCTGATCTTGAGTATACCGGCACTACGGAAAGAAAACTACATCATATC
TTAGCCAGAGTCCCTTGGAACTTCTATGTTTAGCAGAATCCACAGGTCATACATAGGTCAATTGCGTAAAATTCCAATGTGCATATTTCATGACCGCATC
GCGCCGTGAGCGATACTCCAATCCGTTAAGCCGCTTCACGTATTTGGGGTTTGTGCAAATCCAGGGTCAGAAACCCAACTTGCATGCTTACATACAGGCA
TGATAAAAGCCCAGCATTATTGTCAATGCAAAGTCTATCATAGACCCTGGACCATTTCTGGAATATCTTGTCGTCTTCTTGCCAATATGGTTACCATATG
TACCTTATTTTTCCGACATTCCTATATGCGGTGAATAAGAGTTCGTAATTTTCCTACAACTAAAAGTCCAACTGAACAGGCCCAGAGGCATATCCGTGCA
TCCACCCATGCTTGGCTTTCATCTCATCTAACGTTGCGTACCCCCTGTTCGGCACCCCCCCTGTTCGGCACCCAAAAATAACAACACTTTTATTTTTATC
CTCCAACTTCTATTATAAATATCTCGATGAATCTGTCACTTTTGGATTTACTTTTTTCTGATTTTAATTCTCCATTTTCCAATGAAGCAATATACTGAAA
AACAGCTTATATCTGCAATTAACGACGTCAATAATGGCAATCCAATTGCAAAAACCTCCCGAAAATGGGGAATACCTAGGTCTACACTTCAAAGTCGACT
TAAAGGTTCTCAACCTTATAAAAAAGCACAAAGCCCTTTTCAAAGGCTTTCCACGGAACAGGAAAAGCATTTGGCTGATTGGGTACTTACCCAAACAGCT
TTAGGGCTTCCGCCAACGCATCAAGAATTACGCTTTTTTGCCGAACGAATTCTTCAAGCCGCCGGAGAGACAAAAGGCCTTGGAAAACGTTGGATAACTC
GTTTTTTGGCTCGTTATCCAATCCTTACAACCCAAAGGCCCCGTCGAATAGATAACGCCCGGGTTAATGGCGCTACTACGGAGGTAATTAAATCTTGGTG
GCTTTATATTACGAACCCGGTTATTAACGCTATTAAACCGGAAAACCGTTGGAATATGGACGAAACCGGTATAATGGAAGGCAAAGGATCTAATGGCCTA
GTATTAGGGCTTAACGGGATCCGGCCGTTGCAACGAAAAGAGCCCGGAACGCGTGGTTGGACGACTATAATCGAATGTATATCGGCTACGGGCGTTGCCC
TCCCTCCCCTCGTTATATTTAAGGGAAAAAACGTACAACAACAATGGTTTCCCACGGATTTAAGCCCTTTCGATAATTGGCAATTTCATGCAACCGAAAA
CGGGTGGACAAATAACCAAACGGCTATCGAATGGTTAAAAAAGGTGTTTATTCCGTATACCCAACCTTTAACCCCTGAAAAGCGGTTATTAGTTTTGGAT
GGCCATGGATCACATATAACGGACGAATTTATGCTTCTTTGCTTGCAAAATAATATTCAACTCCTATATTTACCCCCTCATTCGTCACACGTTCTTCAAC
CATTGGATCTATCGGTTTTTGGGCCGTTAAAAGAAGCTTATCGACGTCAACTTGGATTTGTTAGCCAATTTTGCTGTTCAACAGTTATTGGAAAACGAAA
TTTCCTACTTTGTTATCGAAAGGCCAGATTAAAAGCATTTATAGCAAAAACCATTCAATCTGGTTGGCGTACAACGGGGTTATGGCCGGTAAACTTGGTT
AAACCACTTTTAAGCCCTTTTTTGTTAGAAAATAGCAACGCCAACGTTATAAAAGATAAAAACAACGGTTTGCAAAGGGATAAAACACCGGAAAGCCCAG
CCCAAAAAATTAACGACCCGTCTTTGACTTATTTGGAAAACCCCTAAAACGACCCGAGATATCCGACTTCAACTGCAAAAACTTTCCCAATCCAACAAAA
CCAACGCTACTTCACGTCTTTTATTTGCAAAAGTCCAAAAAAGCTTCGAAGCCAAAGATACCCTTTTGGCTAGCGCCCAGCAAAAAATCAGCTTATTGGA
AGCACAACTGGAGGCAATACGGCCGGTTAAAAGGAGGAGGGTGGTTCCGGATCCAAACGAGCTTTTGGTTAACAAACAGAACATTATTGGATTGCAGGAA
AATGATATAGAAAATTTGGAACCTTTAGCTGATGAAGAAGAGGTTAATGAACCGGAGAAGCGTGAAAACGATTGTATTTTTGTCCGTTGATAATTTTATA
TTTAAATCAGTTTATAAAAGTAGGCATTTCGTTGTTAGATTTTCAGGGTGCCGAACAGGGGGGGTGCCGAACAGGGGGTACGCAACGTTTTTTTTTTTCG
GCACGAATTTCGTCTGTCATCCCATGGCCCCGGGCAAGTGCCTTGACTGCATGTAAAACTGTGTCTCATGGAGCCTAGCTACAGCAGTTCGTATGACGTA
CGGAGACGAAAAAAAAGAGGTCGCTATCTCGGCCCCGGTTAGTCGGGCCAAACCGAAGCCAGCAGGGTGGGAGAGTGTAGCACAACAGCATGGTACTATA
TGCAGGTGCTACAGTAATTAGTGTTGATAATCATTGCTATCGATTGGCATACCGGTATATATAAACACAACACTACAAAAAACAGCTCCACAGAATACTG
ATCAAGTAGGCGAGCGACGTAAAGCGAGTGAAGTGGAAGCCGAGTACGTAGGTACTTGGTTTTTGGATCTAGTCTGTCCACAAATCAACACGCACCGGTG
GCAGTCCTCCGTGCTCCCCTGGATTTTTTATGTGGCCAATAAAGCCTCAACATACCAAGAGCTATCCATTATGAAGGCCGTGCTGCAAAAGCAAAATCTC
CCATGTACAAATTGTGCCACACTACCTTGCCAAAGTTTCGATGTAAAGAGAATTTGGTGTGGGCGGGGCATCCGGGTGTATCTTGGCCACTGCCGCAGAG
GATTACCTACAAAATACCACATTGAGCATTGTGGCACTGTTGTGGAAAAAAGGAAATATCAGCAGCAGCCAAGGTAGGCAGGTAGGTACCCGAGGCGACC
ACCATCAGCTTCTCAAGGCCTGGCTTGGCTAACTAGCGCAGGTACAAGCTGATCGGAACTACAACAATACTACCAGGACACCACCCATACCGGTAGACGA
TCTTGATACCCTCATTTTTTCCCTTCTTTCTTTTTCCCCTCTTATTATCTTTTGTTCTTGCATTTTTCTCTATCCTTCATTTCTCGCATCAACAACAAAC
ATCATATCAAACGACTCGACTGCTGCCTGTTTATTGTCCGAAATTACGACCAAGACCAGCTGCTGCTTTGCCATTTTGTGCCCGCTGCTACAAGGTACCA
CCGAATCCTCTGGCCCATCTATGAGCCCGCCAGCATGCAGCAGACTGAGAAAAATTTCCGGTCTTCCTCTTGCGCCCCGCACGAATTGGGGTGGATGAAA
GATAACGAAAAAAAAAAATAACAGAGGATGCAAGATGGTAGACGCTTGTCCCCTGATGACTGCCGATGCCTTGCCGCGTCCGTACGTCCATCTTAATTTG
CCTTTATATATGTGGCTGATCGACCAGAGACAAGAAGCTACCGTTGCATCTCTCTCCCTTGCTGACAGAACTCGATCTTCCTTTTCCCACTTTGGATGTA
CTGTAGTGGATGGGCCGCGATCTGAGCTGCAAACTGCACAGTAGTATACAAGCATGTCTCGGCTGTGAACGGCTGGTGCTTGCATAGACATATTGCCTCA
TCGCTTTAGCCGTAACCAGAAAAGACAGGGCTCAGCCAGCCAATCCCTTCGCAAGCCTCTTACATGGGCTCCCGATGTGCTAATTCTGGTATTTCTACCC
GGCGGCCACCACCATGGTCTGCGCCACAAACTGTCTGCACGTCTGGGGTCAGGTACCGATCCCACCCTCCCTTGTCATCATCATCCAACATCAGAGCGCG
TTTATACCGTGTGTATACTGTCGTTGGCTGTGGTTGCTCGGCTCTCTCTCTCTGCCGTGTAGCCCTTAACAGGTGCTCCGACTTGGGTGGTGTGGGCGGC
ACATCGCTATAGCTTCTGCGAATCTAGACCAGAACTGGGGGTTTGCGACTGGGGGAGTGGGCTCGGCCTCGGACCCGGGGCAACTTGCCTGTTTTTTTTT
GTAACGATACACCATGTACAAGAGGTTCCTCGACAGGATAGGAAAAGGGCGAGCTCCTCCTCCTCCTCCTCCTACATCCTCGTTCCCGGGCTCTCACTCG
GCTTCCGCTTCACTCGCTCTACGTCGCTCGCTCTCTCCTACTTGTCATAATACTCATATCAGTATCAACCACAATAATTCCTCTTGAATATAACAACAAC
TGTCACTACCTGCCAACAAAAAAGTCTACGAAATACCCCTGGAAAAGATGAAGAACGTCACCTCTCTCGCCTTGCTGGCCATGGCCACTTTTGCGGTAGC
CGACTATGATGTAAATCACCCTTCTTCTAATGCACCGTCTAAGCGTTCCTTCGGTTCCTCTTCCTATGGTGGTTTCCCAAACAAGGGCGGCAACCCTCCT
ATGCCCGACAAGCCCTACTCTTCCAAGTGCACCACGACCACGACCACCAGCACCACCAAGACCACCACAGTTCAACGCTCATCGTCAACTTTGTCCTGTT
CCACCTCAGCCTCTTCTTCTTTTTCTACTCCGACCAAATCTACCTCCATGTCCACCTCCTGTTCTACTACCGCCTCTTCCTCTGTTTCTTCTTCCGCCTT
TACATCAGTCTCTACCTCCGTTTCCAGCACCGCATCTACCACCGCATCAACCTCTGCCTCTTCCTCCACCTCATCTTCCGCTTATCCGGTTTCCTCGTCC
TCTTCAGCCAAAACCACGACCACTCAGCTCTCCTCTACGTCATCGTCTTCTGCTTCTTCTTCTTCTTCTTTTTCTTCAGCCCAAACCAAGACTGTCGAAA
CCAAAACCATTAACCCTTCGTCTTCAAAGTCGCATAAGCCAAGCCAGCCGCCTCAGAGCTGGACCACCAGCACCTTGACCCTGACCTCGACCACGACCTT
CCTCGAGTGCCCGACCGCGACTCCGGACTGCCCCATCAAAAAGCCCGCCACCACCACCGTCGTCGTCGTCACCACCACCGTGTGCCCCGTCACCAGCGCC
ACCCCGTCGCCCCCTCCGCCGCCGCCCAAGACCACAGCGGCTCCTCCTCCACTTCCTGCGGTCTCTTCGGAGCCACCCAAGACGACCGGAGCTCCTCCTC
CCCCTCCCCCTCCCCCTCCTCCGCCGCCACCTCCTGCTTCCAGCGGATCTCCTGCTCCGCCGCCGCCGCCTCCTCCTCCTCCCAAGACCACCATGGTACC
GCAGCCGCAGCCCCCTACCACCTCGACCACAACCTCTGCGCCGCCGATCGTCACCGCCGCCGCAAACGCTCAGCGTGCCGGTGGTGTCCTGGCCGCCGTT
GCTCTGGCCGCCGCCTTGCTCTAAGCGAAGAGACTGCGAAGAGACTTTGTGGGGTAATTTGCGCGTTGGGCGCAGTGGCTGGGCTGGGATTTTGGAGTTA
CCTGAGGATCTTTAGTGTTGTTTCACAGAAATGAAAAGAGAGAGACTGGTGTGAAACGACAACGGAAAGAAAAAGTACCCCCTCCATGTCAACTGTTTGT
CCCCCCCTCCTTCTACCTTTTTTCCCCTGAGTTTGTTTTCTGCTTTTTCCCCATCAGATAGATGTACTTTTTTGACCTGACGAGGAACTCTTTAATGGTA
TGCACATTTGAACTTTCTCCCATGATTCCATTTATCGTTGTCCAGCCGACCAAAAAAAAAGCTCTCCTGTTGAGATCCTCATTGTCATTGGCCTGAGAAG
TGAAGATCTATATTGAAGAATAACCATAGTGTTCTTGAGACCAGCTCCGATGATGACATGCAGTATTTTCGACCCTTGCCATTATTATTGTTTTGAGACA
CAGCAACGAAGGAAACAAAGAGACGAGAGCGACGGTGGAAATTAGCTATGCATGTCTAGGACTGGTGTATATTCCAAGGGATGGGGGGAGGGGTTTAACA
AGGGAGCAAAGCAAAACAAAGAAACAAAGAAGACGGTGTTTCAAACGAAATACGAGTATGAAATCGGAAGCAAAAGCAAAAAAGAAAACAAAAGCAATCA
TGCCTTTCCAGGATCAGCATTTCCAAGACCCCGCTCGGACCGTTTTCTTTTTCTATAGTACACCATCAGAACCGACGACGCCCAACGAGACCATGAAGCC
GGTTGATGCAAGAGGGATTGCGTCGATCCATAAGAACCTTGACCCCTCGGATGCAAGCCTACGCAAAGCTGCAACCCCTGCCTGCACATCACCCCCAAGG
CGCAATTACATTATGAGCTGTTCTAGGCCTAGTATGCTCGCATCCAGTTTACGTCCACTAGCCTCGTATGTTGCAGGATCAAGAGAATAAAAGAAACATG
AAAATGCCGAACGAGAATATATCACGTAAAGAGAGATATTGTGCTTGTTTACGCGTCAGAAACGTCACATGAATGGAGAAAAGAACTCAAGATCGCGATT
TGTGACCGACACGTGCCTTTGAACGGATGTTATTTCTCTTCCATGTGCTACCCAGATTTATCTCTCTGTCTGACCCCTTTCAAAGTCTCCCATGATGTTT
TTCTTTCCGGGTCACCCATTGTGGCATGCCACTCTCAGATATCTGTGGGCGCCCCCGGAGGCCAAAACCTGAGTCATTTCGAGGGAGGACAACAGCATAG
TACTCGGCGCGGCCGTGAGCTGACGTTTTGGGGTTGCACCCGTACACAAAACACGCCATCCACCCAGCCCGCTGTGGGGGATTTTGGTGGTAGTGCATTG
CATCTGCCGGTAGGCTGGGGCCGAGGCGAAGATAGCGTGCGAGGCTCGCCCAGATCCTTGGGTTACTAGGAAATGGAGTTGCTGGCTCTTCATTTTGTCT
TGTAGTGCGGCATGGTGACAGCCGGGCCAATTAAGCTTTGCTTCGTGCGCCAAACACGCCTGTAAAGGAAACGAAAACAGGTTTTGAGCATGTTCGCCAC
TTGTCACAAAGGTGCCCTGTTTTCCTTGGTTGTCATGCACTCGCTTGTAGCCCAACCATAACATGGTTCTATCTATCAGTGGGGTGATATATTGTATGGT
CGGAGTTCGCCTCATGTTAGCAATTATTGTGTTGCACAACTAAACCGGGCCGAGCATGAAGCGATATGAATGATGGAGTCGTCATAGGCCGGAGCGGGGC
CTGGCTCAGGCTCGTCGTTGGTAGACTGACTTTTGGCAGCCGTGTACTGCCCGTGACCGCCCTGGCACCCTGGGATAGCATTTTAACCGGCCACTGACCG
TTGTGAGCGCCTTGTAAGCAGCAAGCGTTGGAAATTCAGTGTATGGATGCTGAACGAACGCGAACCACTGCTGCCCAGCATAGTCTGTGGGCCTCTGCCC
TGACTATCCTCTCGGCGACGTAGAAACAACGCTGGATGCAAGCCTCTAGGTACCACCAAGTGGCCCGCGCAGCTTGGTAACGACGTCCTCGATCCTCGCA
CAATCGCCAAAGACGTCTTGCTGAGTGACGCGATCGCGACCTCCGTCTGGCAGAACCACAACCGACTGAAGCACCTCGCCACCGGGGCCGATGACGAGCC
GTCCGACGCGACCGTCGCGCCAATCGAACCTGAACTGCGTCGCTGCCGTGTCGACCGGCTCAATGTCCACGATGCCAGCCACCGCCCGCCGCTGCCTCGC
CCTAGACTCACGATCGTCTTCTATCGACTTCATGACGACGGCCTCTGGCGGCTCATCTGCCGGGGTGCCGACAGGAGCCTTGGACCTGTCGTCCAAGCCA
Copyright 2006 Fungal Plant Pathology Lab. & FBL
E-mail : yonglee@snu.ac.kr
Magnaporthe oryzae ATMT Database