Home   Guide to ATMT Database   Sitemap   Contact  
Sequence ID  5334693
Locus Name  MGG_05134.5
Gene Name  
Protein Name  hypothetical protein
Species Name  Magnaporthe grisea [Magnaporthe oryzae 5 PROTEINS]
Protein Sequence
[273 aa]
+  1
101
201

MPTKKWEDEESSSGSSDESSPAVAVSVPRRKFDDEEANDSDVLDSWDAAEDSEVEREKAKKAAEAKAKAEAEAKANKKTKAARINEHKQRRKEAEESDESDDETESQRRERLRRTEKEADLAHAEDLFGDIGVPAGRKVKAASTSVSIDPSDPSKTVELSDMPIFNPKTKTQFEDMRQALIPLITASSGRKPHYNNFMEEFVRQLCADMPSENIKKISSKLTALSNEKMKQEKAAAGTKKTKAAKTKTSLVANRAGVTDTNSYEDTFGDDDFM
DDETESQRRERLRRTEKEADLAHAEDLFGDIGVPAGRKVKAASTSVSIDPSDPSKTVELSDMPIFNPKTKTQFEDMRQALIPLITASSGRKPHYNNFMEE

DNA Sequence
[822 bp]
+  1
101
201
301
401
501
601
701
801
ATGCCAACAAAGAAGTGGGAAGATGAGGAGTCCTCCTCCGGCAGCTCCGACGAGTCCTCCCCCGCGGTTGCCGTCTCAGTCCCCCGCCGCAAGTTCGATGACGAGGAGGCCAACGACAGCGATGTCCTCGACTCGTGGGATGCCGCCGAAGACTCGGAGGTAGAGCGCGAAAAGGCAAAGAAGGCCGCAGAGGCCAAGGCCAAGGCCGAAGCCGAAGCCAAGGCCAACAAGAAGACCAAGGCCGCCCGTATCAACGAGCACAAGCAGCGTCGCAAGGAGGCCGAGGAGTCGGACGAGAGTGACGACGAGACCGAGTCGCAGCGCCGCGAGCGCCTCCGTCGCACCGAGAAGGAGGCCGATCTCGCCCACGCCGAGGACCTGTTTGGTGACATTGGTGTGCCCGCGGGCCGCAAGGTCAAGGCCGCCAGCACCAGCGTCAGCATCGACCCGTCGGACCCTTCCAAGACGGTTGAGCTGTCCGACATGCCCATCTTCAACCCCAAGACCAAGACGCAGTTTGAGGACATGCGCCAGGCCCTGATCCCGCTCATCACGGCCAGCTCTGGCAGGAAGCCGCACTACAACAACTTTATGGAGGAGTTTGTCAGGCAGCTGTGCGCCGACATGCCCTCGGAGAACATCAAGAAGATCTCGAGCAAGCTCACGGCCCTCAGCAACGAAAAGATGAAGCAGGAGAAGGCCGCCGCCGGAACCAAGAAGACCAAGGCCGCCAAGACAAAGACCTCGCTGGTCGCTAACAGGGCTGGCGTGACTGACACCAACTCGTATGAGGATACTTTCGGAGACGACGACTTTATGTGA
ACGAGGAGGCCAACGACAGCGATGTCCTCGACTCGTGGGATGCCGCCGAAGACTCGGAGGTAGAGCGCGAAAAGGCAAAGAAGGCCGCAGAGGCCAAGGC
CAAGGCCGAAGCCGAAGCCAAGGCCAACAAGAAGACCAAGGCCGCCCGTATCAACGAGCACAAGCAGCGTCGCAAGGAGGCCGAGGAGTCGGACGAGAGT
GACGACGAGACCGAGTCGCAGCGCCGCGAGCGCCTCCGTCGCACCGAGAAGGAGGCCGATCTCGCCCACGCCGAGGACCTGTTTGGTGACATTGGTGTGC
CCGCGGGCCGCAAGGTCAAGGCCGCCAGCACCAGCGTCAGCATCGACCCGTCGGACCCTTCCAAGACGGTTGAGCTGTCCGACATGCCCATCTTCAACCC
CAAGACCAAGACGCAGTTTGAGGACATGCGCCAGGCCCTGATCCCGCTCATCACGGCCAGCTCTGGCAGGAAGCCGCACTACAACAACTTTATGGAGGAG
TTTGTCAGGCAGCTGTGCGCCGACATGCCCTCGGAGAACATCAAGAAGATCTCGAGCAAGCTCACGGCCCTCAGCAACGAAAAGATGAAGCAGGAGAAGG
CCGCCGCCGGAACCAAGAAGACCAAGGCCGCCAAGACAAAGACCTCGCTGGTCGCTAACAGGGCTGGCGTGACTGACACCAACTCGTATGAGGATACTTT
Position in Contig 719985 ~ 721107 (1123 bp, 301 bp) in Magnaporthe grisea 70-15 supercontig 5.175 (Strand -) (Frame : -2)
Chromosome Chromosome : Not defined!
Contig Sequence
(709901 ~ 731100)

+709901
710001
710101
710201
710301
710401
710501
710601
710701
710801
710901
711001
711101
711201
711301
711401
711501
711601
711701
711801
711901
712001
712101
712201
712301
712401
712501
712601
712701
712801
712901
713001
713101
713201
713301
713401
713501
713601
713701
713801
713901
714001
714101
714201
714301
714401
714501
714601
714701
714801
714901
715001
715101
715201
715301
715401
715501
715601
715701
715801
715901
716001
716101
716201
716301
716401
716501
716601
716701
716801
716901
717001
717101
717201
717301
717401
717501
717601
717701
717801
717901
718001
718101
718201
718301
718401
718501
718601
718701
718801
718901
719001
719101
719201
719301
719401
719501
719601
719701
719801
719901
720001
720101
720201
720301
720401
720501
720601
720701
720801
720901
721001
721101
721201
721301
721401
721501
721601
721701
721801
721901
722001
722101
722201
722301
722401
722501
722601
722701
722801
722901
723001
723101
723201
723301
723401
723501
723601
723701
723801
723901
724001
724101
724201
724301
724401
724501
724601
724701
724801
724901
725001
725101
725201
725301
725401
725501
725601
725701
725801
725901
726001
726101
726201
726301
726401
726501
726601
726701
726801
726901
727001
727101
727201
727301
727401
727501
727601
727701
727801
727901
728001
728101
728201
728301
728401
728501
728601
728701
728801
728901
729001
729101
729201
729301
729401
729501
729601
729701
729801
729901
730001
730101
730201
730301
730401
730501
730601
730701
730801
730901
731001
TGTGACAGAAGAGACTGGCTCGCCACTTGGTAACGTCAAATGTTTTGCCCCAAAAGCACAATGCAGGTGTGGCAAGTGCTAGAGACGCGGTGAGTAAACT
CCAAGAAAATGGCAGGAGGGCTTGGCGACGGCTTTAATAGTGTTTTGCTCCGATTACTACTCGGTGTCCACCTTCCTAGACTAGAACTAGAACTGGACCG
CTATGAGTATTCACCCGTTCTGAACCCCAAAGTTAGTCTGGACGCCTGGGATGCGATGCCCGTTACCCTGCAAAGGGCTATGCATCTTGTCCTGTTTTACTACTGCATTTGTTAGTGACTCCCCACAAGGAGAGGATATTCCGATCGGAAGCAGCCGGTGGTTTAGAGGCGATAGCGGCCAAAAACTCCGGAAAAGACAAATCCAAACCAAAAAAGCAGACAGATGGAAATGGCTCATCCACATTGTGAGTCGACAAGCACCTTGATAAGGAAGATCTTAAAGGTAGACCCCACCGATATCGTAACCCAATACCCAATCGTAGGTTTGTCTCGGCCCCAACCGTCCATCTGTGATGGGGCTGCTCACACTTCGCAGCCTTTGTGTCATAATATCCCAGTAGCACATAGTCCAGCTTGCCCGGGGCTAAAAGTCCGAGGGCTATCCCCGACAACCGACAAAAAGCCCACAAAAGCCCGAACCATATTCGGTAAGCACCGTAATATATGCGTTATTTGATCGTAATACTGTTATATTTAAACTTGATTTTGATCAAGGCTGGCCCCATCCCAAGCTGCGCCAAACTTGAATAAAAAAGGTATTTCCGTTCCTGGGCCATAAGGCATTTTATGAAATAAAAGAGCAAAGGGACAACAATCAAAGCTTCGACTTCCTTCCAGACTTGATATTCTTGGAAAACTCTCCGCTGATGATAAAGTCGGGGTACCGCATGCCCGGGTCCAGACCGACGCCCGCGTTGGTACCCCTCCAGGCGGCACCGTCAACCACCAGGCAGTGGCCGTTGACGTAGTTGCCCGCCTCGCTGAAGAGGAAGACGGTCGCGTCGCCAATGTCGCGCTTGGTTCCCCAGCGGCCGGTCGGGACCCCAGCCGCGCCCAGCTTGGGGTCCTTGTTGACTTCGCCGCTGGACAGGCGCTCCATGCCCTCGGTCCCCTCAATGCCACCGGGGGAGATGACGTTGCTCGTGATGCCCAACGGGCCGTACTCAATCGCCACCGACGCCATGAGGCTGTCGACGCCCGCCTTTGCTGCCGAGACGTGCGCCTGGAGCGGCACGCCCGTGTAGTGGAAAGTCGCCGAGACGTAGATGATGCGCCCTCCCGTCTGCCCTGTCGGGCTGGGGTTCGGATTCCGCGACGCCGAGGCCACCAGGTGCGGCATCGTCGCCTTGATGGTGTTGAAGGTGCCTATGGTGTCGATGTCGATGACCGACTTGAACCCGTTGGGCGTCAGGGCCGAGATGGGCGCCACAAAATTGCCCGCCGCTCCGGCGATCACAAAGTCGATGGCGCCCAGCTCGCTCGCGCAGCGGTCTGCAGCCTTCTTGAGATCCTCAAACTGCAATTTCATGTCAGCTCAAATATCTTGTTCATGGTGAGACGGTCGTGTACCAACCTTTCTAACGTCGACAGCTCCAATGCCGATAACCTTGGCACCTGGCCGAACCTGGGCGATTTCCCTAGCAACCCTCTCAGTCTTCTCGACGTTGCGGCCGATAATGCAGGCATTGGCACCGAGGTGGACGATGGCTTTTGTCTGAGCACTGCAGATATCGCCAGCACCACCAGTCACAAAAATTACTCGGTCCTCTATTTCATTTTTTGTTAGACCTGATATGCGTATTACTTGCCCATCTAGTATGGGGGCGTCGAGAAGGTAAGAATTGAGGCCTACTAAAAATGCCGTCCTTCCATACGCCGCTCATGTATTCTGTTGCCATGGTCGTAGTTGGTTTGTGGTGAAGCGGCTCAAATTGTCAACTCGATCTGAGTGTTGTATGTCGGATTGGTGACGTCCTGATTGAGTTCAGACTGAGTCGACAGCGAACACTGAAGAGATGGAACAACCACAGGATATAGGGGAAACGGGATTATTTGATGAAGGGAAAGGAAAAACTAGCAGATGGCAGCTAATTTAAAATGGCATTCATAATATCATATCTCAAGAGCTAGCTTTTGATCAGCTTACTTTCTCCCGTTCTCTGTTTTGAACAAGACAGGCGAATGAGAATCCGAGCACACCCATGTCATCCATAAATTCAAAGTCACAACGACAAGAGCGCCCGGTTAACAAAGCGGATGGCCCGAGAAGTTCAAGCGAATTGCTGTCTAAAACGGGTGTGGTACCTCGGCATATGTGGGGTCAGATGCAATGGCGTTGAACCATGCAACTGGGGATTCTTTCAATGTCTGGCTGCCTGGCGAACAAGGCCACCACTAAAGGCCAAAACTGTTAGGTCTAGAACTAATAGTAGGTTCCCCTCTTGTGGTACGGTACTCCAAATTGGCTACTGGTACTAACATCCTAGCAGCCTGGGTGGGGCCACCTTAACAACCACTGAATCAATTTAGTTTGTTTGTCGCGTGCATCACCAACAAAGTCGCGTTTGGTCCACCTGCCGCCATTGCCGTTTGTCAAGGCGTATAATTTTCGTCTCTTGCTCTCAACGGTCGCATTTCCAACAGCAGCACAGCCATTGTAGGGTCGCGGGAGGATATCATTTTGCTTGTAACAGCTGTCAAATAGTCCGAATCAATCATCGCGCTTTACGACTTTGACCAGCGCCACGCAACAAAGACCGTCGTGACGTGTGACTAATTGCTTGGGATCAGCCTCCCCCCTACCGTCACTGACTACCTTAGCTGTTTGGTCCAGACAGGCGAAAAGAGTTGTAAAATTCTCCAATCCGCCGGCTGATACATTTGGCCTCCTGAGCATTAGATGGACGACCACGATGCCCCCGTGGCGTCGACGGCAACGAAGCCCAAGAGACCTCTATTCAAAAAGCGCAAGGTAAAGTCTGCCTCAAACGCACCTGATACCACAGCCTCAGGGGAGCAGGGGGTTGGGATCTCGACCAATGTCAATCTGGACGAGGAGGAGGACGACGGCTTGAACCTCTTCAAGCGCTCCAAGGACTTTTTTCCCGTGTTCGTCAAAGACCGAGAGGAGGAACTGGCAGCAGAAACACGAAAATCAGAAGAATCGAGTGATCGGAAGCGTCGGAAAGTCTCGCCTTCGGCAGATCGTGCATCCCCAAAGTCGGATCTGTATGATGTATCCGAGGATGAGAAAGAACGCATTCGCATAAGGTGAGGATATAGTTGAACCTCTCAGGACCTGTCACGCATAATAGAATATTACATTGGAGCTGGGTTGACCAACATACCACTGAGCAGGCGAGATGAGAGACCACTCACCCCACCACCGACAAAAGACAAGTCATTGTTGAACTCTTCTGGGCGACGATCCGGCCAGCGCGGCGTGGGCAAGGGCAAAGTCAACGCCTCCCCCGCCAGCGCAACACCATCGAGGCGTGCGGCCGCGAGACCAGCCCCAAGTAGCTCCATCGTTATATTCGACTCGGAGGACGAGTATGTTCCCAGGCCTACGGCCAGCAGGAGGTCGCCAGTCGAGACCAAAGAGCCCATAGGGTCGCCGACTCCCACGAAGCAACAGGCGAACAATGCCAAACCGATAGAAATAGACGATGACCTTGAGGAGGTTGCGCCAGCTACCGAAAGCCTGGATGACGAAGACAATGAGTTTGCGCACTTTGTTGTCGCCGCGCGGGAACGTCGGGAAAACCAAAAAGCCGTCCGCGCCGCGGCCGAATCTGTCAGGGGCACAAAGCCAGTCGATGAACGGATTATCCAGGTCTTTGTGACTTCGAGGCTTCCCCCGCCCAAGATGAAACCGGTCGTCCTCAATACGGTGATGCGTAAGCCTATCAAAGTACTGCGGGACACGGTCGTGGCGTTCTCGGCCTCCAGGGGCCGGCCATTGACCGAGGAAGAGCAAAAGGGAGCGTTCCTGGTGTGGAAAGACAGTCGGCTGTACAGCTCCTCCACGCTCATGTCGCTCGGCGTCGTGCCGGATGCACACGGCGGCTTTTCAAAAACGGGTTCAGGAAATGCAAACGACGGCGTGACGGTCGACGGCCAGCTCCACTTTGAGTTGTTCACCGAGGAAATATACGCCGAGTGGATGCAACAGCTGGAAAAGCAGCGTCAGAAAGACCTGTACCAAACGATATCAGATGATGAGGGCGAAACCGGCCAAAAACCGGCCGCCGATGGACAGGACGAGGCTCAAGGCCAAGATGGCAAGAGTTCTGAAAAGATACGCATCTTCCTGAAAGCCAAAAACTTGGATCAGGTGAAGGCGTCAGCGAAGGCTGATACGGAGATTAGTGAGCTCGTCGCCGCCTTTCGCAATGTACGTAAGATTCCGGCAGACAAGCAGGTCGTCATCATGTTTGACGGTGACAAGCTGGCCGAGACCGACACGGTTGGGGATGCAGGGATTGAAGACAAGGACGTTGTTGATGTGCTCATCAAATGACAAAACACATGATGCATCTGGCGGCGTGACTAGCCATTTCTATCATGTTTAGCGCCCAGAAAATGTTATTTTACGAAATGATACCCAAATATGATAATCACAAAATACCTGCGCCTATGCACTTTTGATCGCAAGTCATGACTGAAATATGAATTCGAATATTTTGATGCGTCAATTTTCCGTGGATAAATAGATTACGCCCAAACCCGCAAAAAACAACATCATTACCGAAACCGAAACGCCATGTACTCCGTCATTCCATGCATATCAGACATGCTTTCAAAAAGCTCAGAACCTCTCCTTTTGCCTGGCGCTGATGGTCCTGAGGTTGCCGTAAACTTTGCTAGGGGGCTTGCCAAGAATCAGGTCCACAATGCTCTCCTGAGCCATCCTGACGTTCCTGAAGCTACCGAGAATATGGATCTAACGTTGTCGTCGAGTTAGGCCTTGTAAGATCAAGTGTTCAAGCGATTCGGGACTTCATAAACAATACAAACGTACCTTGCTGTCTGCCAGCACGATACGCGTGCGAGACGCATTCTCAATAGCAAACTTTGTCTTTCCGTCCTTACCAGCAATGCGACCAACACCACGAGCAAGATGATCGCCGGTCAGGGACTTGACATCCTTGACTGGTTTGTTGGGAGTTTGGTTAGCAACCGGTAATGGAATTTACAGCAAAGGAGCCACAACTTACTTTCAAAGGTTTGAATGTACAACTCTGGTACCCTGATCAGGGCAATAGCATCCTGGACTTCGAAACCCAGAGTGTATGCCTTGACAAAGTCCTCTGTCGGCAGCATGTTAGACCCATACTGTGTGCGCATTCGCAAAGGCATAAACTTGAGTATACATACCACCCTTCTGTAGAGATCCAGCCTCGGTTGTGTGCTCTGACGTCCTCAGCTCGACAGCCTTTGTCCTCGTGTTTACGCGCCTAAGAGTCGCAAAAACGTTCCCAAATCAGCACTTGCAGTTTCAAAGCAACTTCGGGCCCTCGCAGCGAACGAGAAAACCCCCTGGCATTAGTTGACTTACACCTGCAGTTTCAAGTGCTCAACCAGCGCCTCATATATTTGCGTCCAGTCCTTCTTGAGCGGCGTCATCCTGTGTGGCGGGATAGGCACCTTCCTCGTCTCCTTCATGACCGACGGTCCCTCGTCCTTTGCCGCGGAAAACTTTGGCCTCGACTCCTCGTCGACCGCCATCTCTGTGTTCTCCTCAGTGGGGGCGGCGATGTCGCTGGCAGCCGGCAGCGTCTGGTCCGTAGTGTCCAGCATGAATTCCTCGGCCTGGTCGGCCTCGACTGCCATACTGCCGTTGTCAGCGACGGGGGCGACGGCTGCGCCATCTTCGATAGCCGCTGTGGGCTTGACCGCTGTCGGGGCGGGCATCGTGTGCGGTGAACTCCGATTGTATGTAGCTTCGAATGTGTTGCGAAAGGCGAAGCAGCTATCGCTGGTGGTTGCAGTGTCCAAATCAGAATTCAAGATTTGTTTCTCCCGTATTTGCCAAATGTAGGTATGCAGCCAAACTAATTGCTCATGGCCCAGCGCGCGACTGTTTGCGCCCCTCTCCAGAATTTTGTGTTTTCTCGCCCAAACTTTTCCCCCCACCAATCCCGAAAATCATTTATCGATAAGCCGCACTTTTCACAGACCCTTGTCGCGAATCCGGGTCCACCGGGAAATAAGCCAAGCAGGGTGCCCCCAGACACTTCAGCGCGTCATAACTTTGCAAGTTAGACGAGCTCTTCATGCGCTGTGGAACGGTTCTTTGCGATTTTTTGCCAACCCATATTTGCTCAAGTTAACATAACAAACAAACAAGGGCCTTTCGGATGACTCAAAAAGCTTACCGCTGAAATTTCGAGCCTGATTTGATGGTGTTCACAGGGATTTGAACTATTTCACCGCCTATATAGGTTCTTTTCCAGAAGAAAGGTTGTGCCCCAGTCGAAGTCCAGAACGAGCCGGAAAAATCCCCCCAACGTCAAAGCTTCATTCAACATGACGATCCGCGACGACCATGCCTAGTACATCCAACCCCCAGCTTGGCCGCCAGCTCTGGGCGGCCATCCGGGATTCCATCGACATTTCCTCAGTTTGGATTCGGTTTCCAGTCAGGACACAGGCTGCGAGATCTCGCTTCCACCATCGACCAGAAGAAGCGCTGAGGTCGCTACAACAATCGCCATTCTCCTCCGCCAAACGATCGTTTCACACTTCAAATACATCACGGCAACGGACGACATCTACGATCTACACGAAGCATTCGCCAGCACACATTAAACGTAACTGCACCTCGGGAAGCTTGCTGCTCCTGGGCCTAGAAACCCCAACAAGCCCTTCGACGCAGACGACCGTCACGACATGCGCTGGGGCAGCTGCCGACTCTGTGCTGCTGGCCTCTGGCGGCAGCTCCAAGCCTAGCATAAGTGCACTGGCACGCCAAGCATGGCGCCGTAACGTACATACAGGCCGGGGAGGTCAGCAAACCCCCCGTAATGACCAGCCAAAGACTAGCAACGACGATGTCAAGTCATCAACCGGAAAGGATGGCGTTTCTGCAACAGGTTCAAGAGACGGCCCCAGCTCTGTCAAGTCCTCGGATCAGGCGAATGCTAGGCCTGATCTCAAATCAGAAGCAAATCCAGCGCCACATGAGGAGACTCTGACTGAATCCATGTCAAAGTATTTGCATATGCCCAAGATGCCTCACAGACCAACCAAGGAAGAGCTACTAGCCGCGGCCAACGGTTTCTTCCAGCGTCTCAAGGTTCGCTTCAAATGGCTATCCATTAGGAGTATGCGACCGTACAACGCCGACGAGTGGGGGGCGTTCGTATCTTGGTTCATGCTGGGTCACCTGGTTTGGATTCTAGTTGGAACAACCACATTTTTCTCGCTGATCATCCTGTTTGTGAACACGGTCTTTGCACAAGGTACGTTACTGACTGTGGCTTACTATGTGGGATTACTGTATTCTGCCGAGGCTGTCCAAGTCAAACCTGAAGCTGACACCAACTCTTCTAGAAACTCTTGCAAAATGGATTGGTGACTACCTGACCCAATCCGCTGGTGTGACAGTGGTATTCGAGTCCGCCATCGTGCCCAAATGGAAGGATGGTGTGATCACTTTCCGAAATGTCTTCATTTCACGCAGACCGGGACAGAGCAAGTCTTCTGTCAAGAAAGGCTCATCGACAAGTGCTGCTGCTGTAGCTGCAGCTAGGCAAACTCAGCCGTCAGAAGAGGATGACGGTAATTACACGCAGTTCGACGTTACTATCAACACAGTAAACGTCACCCTATCGTTTTATAAGTGGTGGAACGGCACAGGACTTCTGAAGGACGTAGAGGTCAAAGGAGTCAGAGGGGTATTGGATCGGACATCGGTCCGCTGGTCAGACGGGCCGCATGATCCCTTTTCATATCGGCACGTTCACCAACCTGGCGACTTTGAGATCGAGCACTTCAAGCTTGAAGATTTGCTACTCACCGTGCACCAGCCTGGCGGGTTCCGCCCTTTCCCAGTCAGCATATATTCCTGCGAGCTGCCTCAGCTCAGGAAACAGTGGTTGTATTACGACTTTCTCAACGCGAACCATTGCTCAGGTTCCTTTGATGGGTCGCTATTCACAATTCATCCTCGCCAAATACATGGAGTGCCCGCTGGCGAGGTAGGCGCATCTGCAGATCATCTTGGCGAGGCTGGTGCTTGGAAGAAGTTCAGCAGAATACGTATAGATGGATTGAAGATTGATCATCTCAACAGGGGCGTCGAGGGTCCCTTTGGGTGGATATACGAGGGCAACGTGGATATGGTGGCGGATCTCATGTTTCCAGCAGACGAAGATGACTCCCTGGGCAAGGTCATGTCGGACTTTTACGACAAAATGGAGGATGCAGTCACAAAGAACAGGTATCTTCGGATACTGGACAAGAACCACAGGGGAGAGCTTGGCGAACGATTAAGCGAAAGATTTTCAAGGCCTGCTACAGTACCTATGGTGGTGCTCGATGAATCCAAGGGCCATGTCTCCGATTACACCACGGCCGATGCCGACTTTGGCCCCTCATCGCCCTCATCACGAACCGAAGAACCTCGAACGCCTGAAGCTGTCGATGAGGAGGAGCCGCCGCGCTACCTGGTGATGGATCTTCGCATCCACCTGAACGATGTTCGCGCAGCCGTTCCGCTCTTCACTCACGACATATCATACATCTCGCAGCCCCTGGTGCGGCCCATCGTGGCCTACATCAACGCCAAGCGCACCTACATTCCTGTCACGTGCCGCATAGTCAAGCGCACCTCAGACTTCAATGGATCCTGGACCCTCTACGACAGCGGTTTGATGGATGACATGAGTGCCGAGGTGTACGACGCGTTTGCTCGTAACGTTGAGGACCAGCACTCGAGGGTCAGGAGACTGAAAAAGGTCGGCTTCTGGACGCTGAGTATGGTTGTCCATGCGCTCCTCGCTGGCGTCGCGGGCGATTTAATATAAAAAGAAAAAGGGAACGAACAGGCCAGGACCGGGTTCCGCGCTGTGTGGGGGTAAAACAGAACCAACACAACCCCCTTCTCAGTGACTTTCGTCTTCCTTTTGGGGACTTTTTTTCATGTATAATAACACATATATCTCTGGATTGTCACATATTTAGGTAGGCTGGGTAACAAAGGGCATGGTCAGCGCGTGTAGAATTGTTTTTTATTATAGTTGCGGCTTTTGGTCTGGTGTACAAAGAAAATTCTTAAATGTTTACTGAATGTGACCTACCCTTCGAGTTATTGGCCATGGAAGCACACAGATATTCACGAATCACGAATCCAGCCTGTTCCGCATGACTTGATGTAGCTTGACCAGTTCATTTCTATTAATCTTGATAACGGGCGACAACTCGCCCAATGTCCCGCTAAATGCCTGACAAATAAAAATCAGAAACGAAAAATTGCAATCTTGTACCCCTGGCTGATCTAGACACAAAAAAACACGACGACGACGGCTTCTACGCATGCGGAAGCCGTCCTCGTATTTCTCTTCTCCCTTGGCGCACTCGCAACCATGGTTAACCTCTTTCCGCATTTCATCGAGGCTTATAGTCTCTTTTGGCACAAAACACCATTTCGCCCTTGAAGACAATCCCTTTCCGATTATCCCATCCAACCTCATATGCACATTAACAAAGACTCTCCCTTTCCCTTCCCCGGAAACGAGTCGAGTCGTCGCCATCTTGCATCACAGCGCTGATGGCAAGAACAAGATAGTCCCCCCAAGCGAGGACTGGTTTTCCTCCCCCTACAGTTGCCCTCTGGAGTCTTGACCCCGCGCCAGTGGCGCGTGGGTAGGACACATCCCGCGACTGATGATAAGTCTGTTTTGGGTGTTTGCAGGCCGGCTCCAGCGCCGATCTATGGTTGGATTCCCCAAGACGCAGTCTTTCTTTTCGCAGGGGTTTATTGGCAGCAACGAAGCGAGAGGGGGAATATTTGATATTGAAAGGCTGTGAGGCGCCTTTCACATAAAGTCGTCGCTACAAAACAAAGTTAGCATCTTCTTCTTGGATCTCTGTTCCGTCTAGTCCCAAAGTTAAAAGAAAGTGCAACTTACTCTCCGAAAGTATCCTCATACGAGTTGGTGTCAGTCACGCCAGCCCTGTTAGCGACCAGCGAGGTCTTTGTCTTGGCGGCCTTGGTCTTCTTGGTTCCGGCGGCGGCCTTCTCCTGCTTCATCTTTTCGTTGCTGAGGGCCGTGAGCTTGCTCGAGATCTTCTTGATGTTCTCCGAGGGCATGTCGGCGCACAGCTGCCTGACAAACTCCTCCATAAAGTTGTTGTAGTGCGGCTTCCTGCCAGAGCTGGCCGTGATGAGCGGGATCAGGGCCTGGCGCATGTCCTCAAACTGCGTCTTGGTCTTGGGGTTGAAGATGGGCATGTCGGACAGCTCAACCGTCTTGGAAGGGTCCGACGGGTCGATGCTGACGCTGGTGCTGGCGGCCTTGACCTTGCGGCCCGCGGGCACACCAATGTCACCAAACAGGTCCTCGGCGTGGGCGAGATCGGCCTCCTTCTCGGTGCGACGGAGGCGCTCGCGGCGCTGCGACTCGGTCTCGTCGTCACTCTCGTCCGACTCCTCGGCCTCCTTGCGACGCTGCTTGTGCTCGTTGATACGGGCGGCCTTGGTCTTCTTGTTGGCCTTGGCTTCGGCTTCGGCCTTGGCCTTGGCCTCTGCGGCCTTCTTTGCCTTTTCGCGCTCTACCTCCGAGTCTTCGGCGGCATCCCACGAGTCGAGGACCTGGAGAGGGTGTGGGGGGTTAGTATTGGGGGATTTCCGAGCTTGGCGAATCAGATGCAGAGCAACATGGCGGCGACGTCACATACATCGCTGTCGTTGGCCTCCTCGTCATCGAACTTGCGGCGGGGGACTGAGACGGCAACCGCGGGGGAGGACTCGTCGGAGCTGCCGGAGGAGGACTCCTCATCTTCTGATGCGGCGGATGAACACTCGTTAGCAGCGTACAAGATGCGCAAAATGAAACAGAGGCGCCATGAGGGGTTGTGCGCATTGCGCGTGTGGTGTTGCTGGCATGAGACAGTCAACTACCTAGTGACGATGGACTTACCCCACTTCTTTGTTGGCATTTTGATGATGTTGATTTGTGAAATATGTTTCGAGGCTGATAACTGATCGAGATCGGATCTTGACGGGCTGTTGCGCCGCAATAAAATAAAAGCGAAACGAGGTTGTAAAGGCAAGAGGGGCTTGAAGAGATGGTGTGAAAGGAAATGTGATTTGGGGTTGAAAAATAGCGCGTAAACAGCAAACATAAATCAGGACACGAATGCAGGCCCAAAGGCTGTCCACAAACCTAAGTCAAGTCTTTTGTGCGTCAACTGCCCTGGCCCCAGCACTTTCAAATCCGTTCCGGCAGCGCGACACTTTTTTTTTTTTTTACTATTATTATTCTACCCGTTTCTTCTCTCGTCGTCAGCAAAATTTACCCCTCCATGGGCAAATCACACGCCAAAATAGAAATTGCAGGGGGTGATCCCACAACCTGGGCGGGCCACATGCCAATGCTCCATCGATGCCCAAATATGCGTCATAGTACCGTTGACTTGCACTGAAGCGAGCCTCCGGTCTATTCCGCTGCTGCAAGTGGTGGATTCCTGACTTTCTTTGTCAATGTAGAATGTCACTCAAATGACCATAAAACACCTCGCCAACCAATCATGATAGTCTTTCCGTTTTCAGATATTCCACCGATCCTTTCGGCGCTCTCTGCCATCTTAAACCCTCTGCACCTCTTAATTTCCTTGGTTTGCCCAATGTCAGCTTGCTGCGTGCATGATCAACGTCGTTACAGTACTTTGCAGAGCCAAGCCTTAAATGAGCAAGAAGACGGCCGGGCTGTCGCTTCAAATATTGCAATGTGCATACTCGCAAAAGTTGCAATTTTAGGGACACGTTTTCTACGAGCGCCTTGACAAGAACCAAGTATCATCTTCCAAAGTTGAGAATTTGCTTTGAAGCCAACCCAGAGAAGGTCGATTCTATTGCAAATCAACCGGTCCAATCAATATAGTACTAACAATGTAAATTTATTTCGACCTGCATACCTACTTGGATACGTCAACCACACACCTAGGTAGGTATGCAGGCATTTGTGTGAACTAAGCTGCTTGTGCATACCGGCCCCAGACCTACGGTTACGGAAGCGCTAACGACTATAACCGTCTTTGACCTCAAACCGGATTGAACACGGAAATTTCCGAATTACAAACAAGCAAAGTAGATATCCGGGCCATCTAAGCGGTTCAAACCACGAAGAAGTCGTCGGTTTTTGTTATTTGTCTCTCATACCCCGAGATAAAGCCAAAAGAGGTGACTGGAGGTTGAACAGGCCCACTTGATCGTGTCAGGACTGAAGGTACCTATGTATATCCGCTGAGAAAGTCTGGGTATAACCAGGCAGAGATTTTTTTTTTCTCATTGTAGAAGTTTCTGCGAGGTTGCCTGTGATTGACACAAGGCGTCGGCAAAGCAATCCAGCATGGCCATGTTGTGGATACGAGCAGCATCAGCCAAGCTTCCTTCCTCACTACATAACCTATGTTGGTTTACTTGGATGTCATCTTCGCAACCAAAATGTCGGGCAACTTTCAAATTTTTAAATCCTTGATTATTGCCTGCGGCGCGATTCGGGGTTTGTTCTGTATTTACTTCAGCAAACTGAGTCACTCATTGCGGCATGCGCTAATATTCACTTCGGCGAATTCAGCCCTACAAGTGGGAAATACGGAGTAGCCCATCCATTCACCAACAGGGTGGACGAAAATCATGCGGGACGGGCAGAGCGGCTCTGCTCAGACCAAAATTTGACCATCTACCGGTAGGCGACGTTGTTGCGATGGGCCTGCAAATGACTGCTGTGCCACCTTATAATCTGACCCGACAAATCCCGAGCCCAATCACCGTCCATCGCCTAGCTTCCTACAACCCCCATTGATTATACTCAGCTGACCTTGCCTTAATACTCCTGCAAGCCTAGGATCAGGACTCAGCACTCCGTGTAGCCTGGGCTTTCGGGCTTTGCGCCTAAAGTTTTGTCTCTTGTCTCCCCGGTATTGCTAGCATGTATACTTAGGATTGGTGCCTCCGTTGAATTTTCGTTTTGCAATGGCCGACCTCGTAACTAGGACCCGGTATCAATTCGTAAGGAAGCGCTGGGCATGATTGTTTGACGTCTTCGTTCCACGACGCATCCCACTGCATGGTGCTTACACCCCCAATATGGAATCGACCAATTGATATAAATGCAACGAAGACCCGTAGCTGACGGATGACTGCTTTGCTTATCCTGAGGCACATGCCCTATATATCAAGCTCACCCACTTACATACTACCCGCATACTCACCTTTCAATCTCACCCTACTACTTCGTTTATCAAACGAACACTGAACGTACCGTCTTGATGCTTGTTCATCAGGTCAACACGAAGCTTTGCTCAGCAAAGCAGTTCACACACCTTGCCAAAGTGGTGACACCTGCCCTGTCCTACCAGGCTTCTTCTGTGTACTCGGCAAACCTCCCTCGCCTAGCCGCTTCACCTCGCCTCTTCTCCACCACGAGCTCCGCGCAGCTCCGAGACTTCTTCCCAGTCAAAGAGACAGAACATATTCGCCAGACGCCGCCAACATGGCCGCACCACGGCCTGACGGAGAAGGAGATGGTGGATGTCGTCCCCGGCCACCGAAAGCCTAGGACTCTGGGCGATAAGTTTGCCTGGAGTCTGGTCCGGATTTCTCGGTAAGAGCTAGATTTATAGTTTCTTATATGATTTAATGGCAACGCCAGAAAACAGAAAAACTGATAGTCGGTCTCTTCTGCATAGCTGGGGCATGGACAAAGTCTCAGGCCTCTCGTCGGAGCAGCAGCAAATCAACAAGGGCAGTCCGACAACGTCAATCGTGGCCGCCAAGCCCTTGACCGAAGCACAATGGCTCAGCCGTTTCATCTTCCTCGAGTCCATCGCGGCCGTGCCTGGCATGGTGGCCGGCATGCTGAGACACCTCCACTCGCTCCGGCGTCTGAAGCGCGACAACGGCTGGATCGAGACGCTGCTCGAGGAGGCGTACAACGAGCGCATGCACCTCCTGACCTTCCTCAAGATGTGCGAGCCGGGCTGGCTCATGAAGATACTCATCATCGGCGCGCAGGGCGTCTACTTCAACGCCATGTTTGTCGCATACCTCATCAGCCCCAAGATTTGCCACCGCTTCGTCGGGTACCTTGAGGAGGAAGCCGTGCACACGTACACCAGGAGCATAGAAGAGCTGGAGAGAGGAGACCTGCCCAAGTGGTCCGATCCGAAGTTCCAGGTGCCAGAAATTGCCGTATCATACTGGGGCATGCCAGAGGGCCACAGGACGATGCGAGACCTGTTGTTGTATATCCGAGCCGACGAGGTGAGTTTTTCCCGGCTGTTTTTTGAGCTCCAAAAGTATCCACCAAGTATAAATCAGCATGCTGACTAGATCGATTCTCCTAGGCGAACCATCGTGGTGTCCATCACACCCTCGGCAACCTGAACCAAGTTGAGGACCCTAATCCGTTCGTCAGCGACTACAAAGGTGACAAGCCGCGGCCTGTTGCAGCGTCACGACCAGAAGGTTTTGAGCGGGAGGAGGTTATTGGCAAGGAGGTTATTGGCAAGGAGGTTATCGAAAAGGATGTTATAGGAAAGGAGGTTCTTGGAAAGCAGGTTTCAGTTTGAGGAATCTGCCACTACGCAAGACTGACACAAAGAGAAGAGAGAAGAAAGAAACATTTTGTTGTTTTGGCACAACAGATGACATCCAAAAGTTATCTGTCTGCCTGCGTTTAGTTGTATACCCGAGTCTAGCTCTCCCACGTTTTGTAACATAGACCTTTTGTTTGCTTGCCTCTTTGCACGGAAGACTCGCTGATGTTAGCTTTTGTCAGGCAATGGCATATCACATGAGCTGTAATAGTCATGAGGAAAGCAAAGCCACATGGGGAACAACCCCGAGCATGTTTGCTCGGAACGCAACCGTTCGGCTAACTAGGTACATTGTGTGTTGGAATGAGCTTGCCGCACTCCCCCTCAACCGGCCCCTTCAACCGGGGTTCAACTTCGCACTAAAGGGGTGGGTGTGAGTTGGGTTGGAAGGAATGCAAAGTAAACCAATCCAGGCAAACGAGGAATAAGGTCCTAGGAACATTAAGGTTCACGGCAGCCCTATGACTGCCGACCTCTACCAATCTGCAGGTGCTCGGTCGTCGGGCTACAGTGCATGGATGTCTTCGCACCCCGTCAGCTTGCGATCCGGGTCGGCGGCGGCATTAGAGCACGGCCCGCGAGTAGCACAGCCTCGAAGCAACGCCTCCCGTTCGATCCAACCTAGCCTGTCTGTAGCGTGCAATTACTTTTCAATTGGACGAAAACCTTCAGCAAGCCTCTTGTGTTTACCGGTAGCAGCCGGTGCCGTAGATAGTTTGTACCACGTACAAAACGGTGTGTACCTGGCTTCATTGGCGAGTTTTCGGGACCGTTGCTACAAAAGAAGGGCTCGGTCGATCAATAGTTTTAACTGGAGCCAAGCTTGTTAATCTATTTCCGTCACATAATCCCGGGTTTGATTGGATGAAATCCGTCAAAACCATGGATGATGTGAGACGATGGGTGAGATATGGATCGATGAGGGGTTAATGCTGTGCAAGGGCGACGGCTGTTGAACGAACCGAAAGGAGCAAATCAAAAGTTTGTGCAAAATATCGGATCGCTTGCTTCTGCCTGGAGCTCCTCGCCGGTTTGTTAAACTCTACCGTGTGATCGGTGATGGCTTTTGTAATAGTAAGAAAAGGAAAACCTTGTCTGGTCCAGTAAAAAGATCCGGCGCGTTGAATCCAAGGCACCTTTGGTACGGAATTTCGTATCGTCTGATGGACTTGGTGGGGTTCCCAAGCAACCAGCGTGGAGGGACCTTGCTTGCGGAGGGTAGGTACCCACCTCGGTAACTGCCAAACTTTGAGCGCAAATGAGCTATTCGACGCGAGGGATACACAGTGCATAAACCCCTTGTCGCATTTGGCGCAAACTGTTCTGCAATCATCCACCACTCTGTTCATGTACCAGTAGGTAAGGTAGTTTCAAAGATGGCCAAGCGCAGCAAAAAGAGTAGACAAACAAGTTAATCCAGTCCAAGTGTCATCGGTTCAAGTAAAATTCAGCGAGGTCGGATGATTTTACCCATTCTTGCTGCCTTTATTGTAAGGACTGAGTAGGTTCTCCGTATCAATTTCATGTGATATCCAATGTTACCCTGGCACGTATCGGCCAACAATCTACCTTCGGTAGTGCATACTCATATGTACTGTACAGTATAAGTGTTCATCGAATGTTGTGGGCTTGGACATCGTCAGAAATTAGATCTTGTACGTGGTACCGTACGATACGTTGACTAAAACAAGGAGAAATTCATAACTACCACGCAGATTATTACCATGGAATTTTTCGAGACGTCTCGGTTCAACCGCGAAATCAATGATTGATTTATTCATGCAATCGTCCGCACCCCTCTTGTTCCTGACAGCGAACCATCATCGCCAGCACTGCCTCCATGTCATCCTAGGTGTTATCACGACACGAGCCGTCGTCTGGTCCCTGACTTGGTCTGGTTTCGACGTATATGTTTGACAAGCTGTGTAGTAGCGAGAACTACATGGCTCACGAGTTGGAATCAGGCACGAGAATATGGTAACCGTAATTTCATGACGCCAGGATGTTTGTGCCAGTTGAGAGGGATCAAAATATCTACCTACCTTAGGTACCCAGGAGCTAGTTATTCAAGGACCTGACCCAGCAAAAACACAATTTCCTGAAACCGGCTTTTATAAAATAGAAATTTACTGACACTGCTGTTGTCACGTTTCGGGTCAAGGCAAACAAGCAACAGCCAAGGAATGAGATTGGTTATACATACACTTCGGCGAGATGGAACAAAAGAAATGACGGTGTACACATACCTACCTTAGAGGCCATACGGTGTAGGCCAATCTCACACATTCAACGCAGGACACACAAGTTTGCTAGTTGCATTACCAAAAATAACTGCTCCTGCCTAGTTCGATCGTGTAGCCTCGACCAACATTAGCCTGACCGCCGCCGCCGTTGTGAATTACCTACCGGTCTACCTACCTAAGTATCCAAGCAAATCACTGGCAACTGTTTTAAAAGTCCGTCATCCAAGTCGTCGGACACTCTTACGTCTATGTTTGTATTTGGTAGATCCGAAAAGGCACGCGTCCACTTTTGTGCTGCTCGTCATCAATTGGAAGTTACCTGGCGTGCTGCCTCAATTTCCAATTTCGTAGATCCCCACCCACAGGCCGTGTTTCGACCAATCGTGCCGTACTGCATACTGCGCCGGTGGTCGGTACCTGCCTCCACTGCCTACAAGTACATACCTGCACCGGCCAACGGCTTGGGCAGGTCGCCCCAACCCACTCAGCAACTTTAAGGTTCCTCCTCCATTTTTGCCCGCGGATCTTAATCCACCACCACAACCCCTCGAATCGGGCGCTTGTCGCAACGACCTGTCGAGATAACATCGTATCGCAGCGTATCTCATGGCATCCATCTAGTTCTAATTCTAGTTCTAGTTCAAATCGCGTTGACAAACAATCATCATACTTTGTTTTCCCACTATCCCTGCTCGAGGTCGACCACGGGATTTGCATCTCTATCCCAAACACGGCTCCTCCATTCCCTTCGTCGCGGGCACTTCCCTGCCAATCCCGGGACCGACTTGATTGGTTCTGCCCTGCTGTCAGCTCGCCAAAATACACAGCCCCCCACATCCGCTAGGCACTGCCACCACACCACGAAGGCTGACTCGTTTTCTGCCTCGTCTTGCTCGAGTCTTGCCTTGCCTGGTCCATTCTCATCTGCCCGCGTTTTGCGTCTGGTGCAGGTTAGGTTCCAACCCACAAGAATAGGCACAAGCTCTTTGCTACGGTGTGTGCGCGCGCGACTTCTCCGTCATCACCTCTCTGGTGAGACCGCTCTGCACCGCGCCGAAACAACCTTAACAGTACGCCCACCATTCCAACAGCTACGGTGCGCAGCACAGCACGGCACTGCACCAAATCGAATCGAATCGCACCACCCGCTGCCACCGCATAGCTTTCGCCATGGATCAGTTGCAGCACCACCAGGGTCCCGGGCGCGCTCGTTCGCCATCAGCCGCCAGTACTGGCGCTGCCTTCCAGCAACAACACCAGGAACACCCGCAGCCTCATATAAGAAGCCACTCGCCGGCGCCTGCGCCTCAGTCATTCTCGAGCCCCCAACATAATGGTCTCGGGCTTGGTATCGAACATTCGCAGTCCTTCTCAGGCTTCAACCCCAATCCTAGCGACTTCCTCAACCCCCAACCGTCTCAAACGTTCCCAAGCCAGGGCCAGCTAGACCCCTCATCCTTCGACGCGACTCAGCCGTTCGACAGCAACAACCAGGCCCAGCCAGGATATTCACAAGAGTTCTTGAATAATAACAACAACTTTGGCGGCTCTGACTTTTCTCTTTTCCCTCCTGCAACTACAGAACAGCTCAGCACGCCCTTATTTGTAACGGGAGACAATCAACAGCAGCCGCCCCAACTCAGCACCCCAGACCTGAACATGAGCACGTCCCAAGTCCACCATAGCCCGACACCTCCCCACCATCTGAAGCCGGAACCGCATCAACCCGGCTCCGCCCACCAGTCCCCGTCATTCAACCAGCACCAGTTCTCGTCGCCGCCTGCCCGTCACTCGCGCCATGCCTCGTTAGGTCCTGAGGCGGCCCTGCTACCAGGCCAGGTCGACTGGAGCGGTACACAGTTTCAGGGACACAGGCGCACCCCTTCAGAGTATTCGGATGTGTCATCCGTTGCTCCATCGCCCAACCTTGTCAGCCATGATAGCTTTGATCATATCGAGCATAGCCCGATGCAACGGCCCGTCGATACGGCCGGCCTATACCAGGAGCTCCACGGCCTGGGGAACTTTAGTCTCGCCGATCCCCCGCCTCCTCATGCTCACAGCCCTGATCTAAGAGGCAGGAGTCCGTCGCACAGCCCAGCAATCTCCCCGAGGATCCCGCCACAGCAGCTGCCCGACATGAACCAACCCAACAGTAGCTTCATGCTTCAAGGCCAGAATGGCTTTGGCACCCCCCAGATTGCCCTGCAGTCCTCCGAGGCCTTTCCTCAACTGCCACAGCATGGCTTGGCGCAGATGGCGGCGCCGACAATCAACATCGATTATGCGCCGACGAACCTGAGAAACTTTGAGGGCAGACCGATGATGGACTCTGATGCGCTGACCCCGCCGGATAGAGGTTCGTGGACGTCCTTGCTTGTTTTGCTGTGTTGGAACGGCCAAGCATCCACTTCGCGACGATAATGAATCAATGCTAACACAAAAGTTTATACTTTAGGACGCGTAAGAAACCGCCCACGTGCTGTCACGGATCCTTATGCCAATGGAAGTACCGCGCCTCTTCCGCGACCTCTTGGTACAGCCAGCTTGTCTCCCAGCCCAGGGCTGTCATCAAGAGACTCATCGCGCTCCTTGTCACCATTGGATCGCTCGATACCACCAAATAAGAGGCGTCAGTCCACCTCTGCGGTGCCCAATAATGTCATGGCCCTACGTCTTGCAGACCCTGAATTCGCAGCTCAGGGCAGTGGAGACGGGACTGCGGCAGGCGGCGGGCCGAAGCGGGTCCAGAAACACCCCGCAACATTTCAATGCTCATTATGTCCGAAGCGGTTCACTAGAGCCTACAATCTTAGGAGCCATCTGCGCACCCACACTGATGAGAGGCCGTTCGTGTGTACGGTGTGCGGCAAGGCGTTTGCTCGGCAGCATGATCGGAAAAGGCACGAAGGCCTGCATTCTGGAGAGAAGAAGTTTGTCTGCAAGGGTGACCTTAAAGCTGGCGGGCAATGGGGTTGTGGCAGGAGGTTTGCCCGTGCCGATGCGCTGGGTAGACATTTCAGGTCTGAGGCAGGCCGTATTTGCATCAAACCTTTACTAGATGAGGAGATCATGGAACGGCAAAGAATCTGGCAGGAGCAGCGCATGCAGGCGGCGCAACACCAGCAGCACATGATGATGCCGCCTCCAGGCATAGACCCCAACACCGGATATCCCGTGGACGCTGCTGGTAACTACTCATTACCGGCCGCGATTTTGGCGCAGTATCCTGCCCTTGCCCAGATGAACTGGGGCACGGCCGGCGGCGGCATCGATGGCGGATCAGGCATTGAGGATGATATTTCGGGCCGCAGTAGCTTTGATGCCAGCGATTACGACGATGCCGACGATGGCGGATATGTGTCTGGGCCCGGGACCGGATTTGGTCAGGGCGGCATGAACGAAGGGTTTGGTGAAATGGGGTACGCAAGTGACTACGGTGGTCGCTAGTCTTGATGACAATTTGATACGAGATGCCTGAGTTGCCCAGACATTTGATGAACGGCGGGATTGTTCCATTTTATGACTACTACCTGGATGGCCACTTTACGTTTGGATAACGATGTTTGATGTTTTAGCATTGTGGAGCTCTCAGCCATTCCTGGGTGCGAATACTCGGCGAGGGCTTGAGACCCCCCCTGTGATGGTTCCACGGATCTACGTTTTCTTATTTCTTATTCCTTACTCTTTGTTAAGCTTTGTTTTGGGTGGTTTGCCCTAGCCGAGCATAACGACCTTGATGGTTTGTTTATGTACTTTTGCGGGGTTCGGATTCCATTTGCCTCTTATACCTTTTCTCGCGGTTGTCCTGTTGTTATTTCTTTTTATATAGACGGCATTTCTTGGATGCCACAGAGATACCAATCCTGTTCAAGCTATTGCTGTATGCTTTACATATACCACCAGGCTGTGAGATAATGTGCTTTCTTGGTTTTCCTCGGAAAGAGGGGTTCGACCAAAGTCAACTTGCCATCCGATCCTGATGATTGCTGTCGAATATTACAAATCCATTACTGGACCGCATCCCATTGACAAGTGACACTGGCATGGTTGGTTGTAATGGCGACGATCAAAGACGATGGTAGAA
TACTGCATTTGTTAGTGACTCCCCACAAGGAGAGGATATTCCGATCGGAAGCAGCCGGTGGTTTAGAGGCGATAGCGGCCAAAAACTCCGGAAAAGACAA
ATCCAAACCAAAAAAGCAGACAGATGGAAATGGCTCATCCACATTGTGAGTCGACAAGCACCTTGATAAGGAAGATCTTAAAGGTAGACCCCACCGATAT
CGTAACCCAATACCCAATCGTAGGTTTGTCTCGGCCCCAACCGTCCATCTGTGATGGGGCTGCTCACACTTCGCAGCCTTTGTGTCATAATATCCCAGTA
GCACATAGTCCAGCTTGCCCGGGGCTAAAAGTCCGAGGGCTATCCCCGACAACCGACAAAAAGCCCACAAAAGCCCGAACCATATTCGGTAAGCACCGTA
ATATATGCGTTATTTGATCGTAATACTGTTATATTTAAACTTGATTTTGATCAAGGCTGGCCCCATCCCAAGCTGCGCCAAACTTGAATAAAAAAGGTAT
TTCCGTTCCTGGGCCATAAGGCATTTTATGAAATAAAAGAGCAAAGGGACAACAATCAAAGCTTCGACTTCCTTCCAGACTTGATATTCTTGGAAAACTC
TCCGCTGATGATAAAGTCGGGGTACCGCATGCCCGGGTCCAGACCGACGCCCGCGTTGGTACCCCTCCAGGCGGCACCGTCAACCACCAGGCAGTGGCCG
TTGACGTAGTTGCCCGCCTCGCTGAAGAGGAAGACGGTCGCGTCGCCAATGTCGCGCTTGGTTCCCCAGCGGCCGGTCGGGACCCCAGCCGCGCCCAGCT
TGGGGTCCTTGTTGACTTCGCCGCTGGACAGGCGCTCCATGCCCTCGGTCCCCTCAATGCCACCGGGGGAGATGACGTTGCTCGTGATGCCCAACGGGCC
GTACTCAATCGCCACCGACGCCATGAGGCTGTCGACGCCCGCCTTTGCTGCCGAGACGTGCGCCTGGAGCGGCACGCCCGTGTAGTGGAAAGTCGCCGAG
ACGTAGATGATGCGCCCTCCCGTCTGCCCTGTCGGGCTGGGGTTCGGATTCCGCGACGCCGAGGCCACCAGGTGCGGCATCGTCGCCTTGATGGTGTTGA
AGGTGCCTATGGTGTCGATGTCGATGACCGACTTGAACCCGTTGGGCGTCAGGGCCGAGATGGGCGCCACAAAATTGCCCGCCGCTCCGGCGATCACAAA
GTCGATGGCGCCCAGCTCGCTCGCGCAGCGGTCTGCAGCCTTCTTGAGATCCTCAAACTGCAATTTCATGTCAGCTCAAATATCTTGTTCATGGTGAGAC
GGTCGTGTACCAACCTTTCTAACGTCGACAGCTCCAATGCCGATAACCTTGGCACCTGGCCGAACCTGGGCGATTTCCCTAGCAACCCTCTCAGTCTTCT
CGACGTTGCGGCCGATAATGCAGGCATTGGCACCGAGGTGGACGATGGCTTTTGTCTGAGCACTGCAGATATCGCCAGCACCACCAGTCACAAAAATTAC
TCGGTCCTCTATTTCATTTTTTGTTAGACCTGATATGCGTATTACTTGCCCATCTAGTATGGGGGCGTCGAGAAGGTAAGAATTGAGGCCTACTAAAAAT
GCCGTCCTTCCATACGCCGCTCATGTATTCTGTTGCCATGGTCGTAGTTGGTTTGTGGTGAAGCGGCTCAAATTGTCAACTCGATCTGAGTGTTGTATGT
CGGATTGGTGACGTCCTGATTGAGTTCAGACTGAGTCGACAGCGAACACTGAAGAGATGGAACAACCACAGGATATAGGGGAAACGGGATTATTTGATGA
AGGGAAAGGAAAAACTAGCAGATGGCAGCTAATTTAAAATGGCATTCATAATATCATATCTCAAGAGCTAGCTTTTGATCAGCTTACTTTCTCCCGTTCT
CTGTTTTGAACAAGACAGGCGAATGAGAATCCGAGCACACCCATGTCATCCATAAATTCAAAGTCACAACGACAAGAGCGCCCGGTTAACAAAGCGGATG
GCCCGAGAAGTTCAAGCGAATTGCTGTCTAAAACGGGTGTGGTACCTCGGCATATGTGGGGTCAGATGCAATGGCGTTGAACCATGCAACTGGGGATTCT
TTCAATGTCTGGCTGCCTGGCGAACAAGGCCACCACTAAAGGCCAAAACTGTTAGGTCTAGAACTAATAGTAGGTTCCCCTCTTGTGGTACGGTACTCCA
AATTGGCTACTGGTACTAACATCCTAGCAGCCTGGGTGGGGCCACCTTAACAACCACTGAATCAATTTAGTTTGTTTGTCGCGTGCATCACCAACAAAGT
CGCGTTTGGTCCACCTGCCGCCATTGCCGTTTGTCAAGGCGTATAATTTTCGTCTCTTGCTCTCAACGGTCGCATTTCCAACAGCAGCACAGCCATTGTA
GGGTCGCGGGAGGATATCATTTTGCTTGTAACAGCTGTCAAATAGTCCGAATCAATCATCGCGCTTTACGACTTTGACCAGCGCCACGCAACAAAGACCG
TCGTGACGTGTGACTAATTGCTTGGGATCAGCCTCCCCCCTACCGTCACTGACTACCTTAGCTGTTTGGTCCAGACAGGCGAAAAGAGTTGTAAAATTCT
CCAATCCGCCGGCTGATACATTTGGCCTCCTGAGCATTAGATGGACGACCACGATGCCCCCGTGGCGTCGACGGCAACGAAGCCCAAGAGACCTCTATTC
AAAAAGCGCAAGGTAAAGTCTGCCTCAAACGCACCTGATACCACAGCCTCAGGGGAGCAGGGGGTTGGGATCTCGACCAATGTCAATCTGGACGAGGAGG
AGGACGACGGCTTGAACCTCTTCAAGCGCTCCAAGGACTTTTTTCCCGTGTTCGTCAAAGACCGAGAGGAGGAACTGGCAGCAGAAACACGAAAATCAGA
AGAATCGAGTGATCGGAAGCGTCGGAAAGTCTCGCCTTCGGCAGATCGTGCATCCCCAAAGTCGGATCTGTATGATGTATCCGAGGATGAGAAAGAACGC
ATTCGCATAAGGTGAGGATATAGTTGAACCTCTCAGGACCTGTCACGCATAATAGAATATTACATTGGAGCTGGGTTGACCAACATACCACTGAGCAGGC
GAGATGAGAGACCACTCACCCCACCACCGACAAAAGACAAGTCATTGTTGAACTCTTCTGGGCGACGATCCGGCCAGCGCGGCGTGGGCAAGGGCAAAGT
CAACGCCTCCCCCGCCAGCGCAACACCATCGAGGCGTGCGGCCGCGAGACCAGCCCCAAGTAGCTCCATCGTTATATTCGACTCGGAGGACGAGTATGTT
CCCAGGCCTACGGCCAGCAGGAGGTCGCCAGTCGAGACCAAAGAGCCCATAGGGTCGCCGACTCCCACGAAGCAACAGGCGAACAATGCCAAACCGATAG
AAATAGACGATGACCTTGAGGAGGTTGCGCCAGCTACCGAAAGCCTGGATGACGAAGACAATGAGTTTGCGCACTTTGTTGTCGCCGCGCGGGAACGTCG
GGAAAACCAAAAAGCCGTCCGCGCCGCGGCCGAATCTGTCAGGGGCACAAAGCCAGTCGATGAACGGATTATCCAGGTCTTTGTGACTTCGAGGCTTCCC
CCGCCCAAGATGAAACCGGTCGTCCTCAATACGGTGATGCGTAAGCCTATCAAAGTACTGCGGGACACGGTCGTGGCGTTCTCGGCCTCCAGGGGCCGGC
CATTGACCGAGGAAGAGCAAAAGGGAGCGTTCCTGGTGTGGAAAGACAGTCGGCTGTACAGCTCCTCCACGCTCATGTCGCTCGGCGTCGTGCCGGATGC
ACACGGCGGCTTTTCAAAAACGGGTTCAGGAAATGCAAACGACGGCGTGACGGTCGACGGCCAGCTCCACTTTGAGTTGTTCACCGAGGAAATATACGCC
GAGTGGATGCAACAGCTGGAAAAGCAGCGTCAGAAAGACCTGTACCAAACGATATCAGATGATGAGGGCGAAACCGGCCAAAAACCGGCCGCCGATGGAC
AGGACGAGGCTCAAGGCCAAGATGGCAAGAGTTCTGAAAAGATACGCATCTTCCTGAAAGCCAAAAACTTGGATCAGGTGAAGGCGTCAGCGAAGGCTGA
TACGGAGATTAGTGAGCTCGTCGCCGCCTTTCGCAATGTACGTAAGATTCCGGCAGACAAGCAGGTCGTCATCATGTTTGACGGTGACAAGCTGGCCGAG
ACCGACACGGTTGGGGATGCAGGGATTGAAGACAAGGACGTTGTTGATGTGCTCATCAAATGACAAAACACATGATGCATCTGGCGGCGTGACTAGCCAT
TTCTATCATGTTTAGCGCCCAGAAAATGTTATTTTACGAAATGATACCCAAATATGATAATCACAAAATACCTGCGCCTATGCACTTTTGATCGCAAGTC
ATGACTGAAATATGAATTCGAATATTTTGATGCGTCAATTTTCCGTGGATAAATAGATTACGCCCAAACCCGCAAAAAACAACATCATTACCGAAACCGA
AACGCCATGTACTCCGTCATTCCATGCATATCAGACATGCTTTCAAAAAGCTCAGAACCTCTCCTTTTGCCTGGCGCTGATGGTCCTGAGGTTGCCGTAA
ACTTTGCTAGGGGGCTTGCCAAGAATCAGGTCCACAATGCTCTCCTGAGCCATCCTGACGTTCCTGAAGCTACCGAGAATATGGATCTAACGTTGTCGTC
GAGTTAGGCCTTGTAAGATCAAGTGTTCAAGCGATTCGGGACTTCATAAACAATACAAACGTACCTTGCTGTCTGCCAGCACGATACGCGTGCGAGACGC
ATTCTCAATAGCAAACTTTGTCTTTCCGTCCTTACCAGCAATGCGACCAACACCACGAGCAAGATGATCGCCGGTCAGGGACTTGACATCCTTGACTGGT
TTGTTGGGAGTTTGGTTAGCAACCGGTAATGGAATTTACAGCAAAGGAGCCACAACTTACTTTCAAAGGTTTGAATGTACAACTCTGGTACCCTGATCAG
GGCAATAGCATCCTGGACTTCGAAACCCAGAGTGTATGCCTTGACAAAGTCCTCTGTCGGCAGCATGTTAGACCCATACTGTGTGCGCATTCGCAAAGGC
ATAAACTTGAGTATACATACCACCCTTCTGTAGAGATCCAGCCTCGGTTGTGTGCTCTGACGTCCTCAGCTCGACAGCCTTTGTCCTCGTGTTTACGCGC
CTAAGAGTCGCAAAAACGTTCCCAAATCAGCACTTGCAGTTTCAAAGCAACTTCGGGCCCTCGCAGCGAACGAGAAAACCCCCTGGCATTAGTTGACTTA
CACCTGCAGTTTCAAGTGCTCAACCAGCGCCTCATATATTTGCGTCCAGTCCTTCTTGAGCGGCGTCATCCTGTGTGGCGGGATAGGCACCTTCCTCGTC
TCCTTCATGACCGACGGTCCCTCGTCCTTTGCCGCGGAAAACTTTGGCCTCGACTCCTCGTCGACCGCCATCTCTGTGTTCTCCTCAGTGGGGGCGGCGA
TGTCGCTGGCAGCCGGCAGCGTCTGGTCCGTAGTGTCCAGCATGAATTCCTCGGCCTGGTCGGCCTCGACTGCCATACTGCCGTTGTCAGCGACGGGGGC
GACGGCTGCGCCATCTTCGATAGCCGCTGTGGGCTTGACCGCTGTCGGGGCGGGCATCGTGTGCGGTGAACTCCGATTGTATGTAGCTTCGAATGTGTTG
CGAAAGGCGAAGCAGCTATCGCTGGTGGTTGCAGTGTCCAAATCAGAATTCAAGATTTGTTTCTCCCGTATTTGCCAAATGTAGGTATGCAGCCAAACTA
ATTGCTCATGGCCCAGCGCGCGACTGTTTGCGCCCCTCTCCAGAATTTTGTGTTTTCTCGCCCAAACTTTTCCCCCCACCAATCCCGAAAATCATTTATC
GATAAGCCGCACTTTTCACAGACCCTTGTCGCGAATCCGGGTCCACCGGGAAATAAGCCAAGCAGGGTGCCCCCAGACACTTCAGCGCGTCATAACTTTG
CAAGTTAGACGAGCTCTTCATGCGCTGTGGAACGGTTCTTTGCGATTTTTTGCCAACCCATATTTGCTCAAGTTAACATAACAAACAAACAAGGGCCTTT
CGGATGACTCAAAAAGCTTACCGCTGAAATTTCGAGCCTGATTTGATGGTGTTCACAGGGATTTGAACTATTTCACCGCCTATATAGGTTCTTTTCCAGA
AGAAAGGTTGTGCCCCAGTCGAAGTCCAGAACGAGCCGGAAAAATCCCCCCAACGTCAAAGCTTCATTCAACATGACGATCCGCGACGACCATGCCTAGT
ACATCCAACCCCCAGCTTGGCCGCCAGCTCTGGGCGGCCATCCGGGATTCCATCGACATTTCCTCAGTTTGGATTCGGTTTCCAGTCAGGACACAGGCTG
CGAGATCTCGCTTCCACCATCGACCAGAAGAAGCGCTGAGGTCGCTACAACAATCGCCATTCTCCTCCGCCAAACGATCGTTTCACACTTCAAATACATC
ACGGCAACGGACGACATCTACGATCTACACGAAGCATTCGCCAGCACACATTAAACGTAACTGCACCTCGGGAAGCTTGCTGCTCCTGGGCCTAGAAACC
CCAACAAGCCCTTCGACGCAGACGACCGTCACGACATGCGCTGGGGCAGCTGCCGACTCTGTGCTGCTGGCCTCTGGCGGCAGCTCCAAGCCTAGCATAA
GTGCACTGGCACGCCAAGCATGGCGCCGTAACGTACATACAGGCCGGGGAGGTCAGCAAACCCCCCGTAATGACCAGCCAAAGACTAGCAACGACGATGT
CAAGTCATCAACCGGAAAGGATGGCGTTTCTGCAACAGGTTCAAGAGACGGCCCCAGCTCTGTCAAGTCCTCGGATCAGGCGAATGCTAGGCCTGATCTC
AAATCAGAAGCAAATCCAGCGCCACATGAGGAGACTCTGACTGAATCCATGTCAAAGTATTTGCATATGCCCAAGATGCCTCACAGACCAACCAAGGAAG
AGCTACTAGCCGCGGCCAACGGTTTCTTCCAGCGTCTCAAGGTTCGCTTCAAATGGCTATCCATTAGGAGTATGCGACCGTACAACGCCGACGAGTGGGG
GGCGTTCGTATCTTGGTTCATGCTGGGTCACCTGGTTTGGATTCTAGTTGGAACAACCACATTTTTCTCGCTGATCATCCTGTTTGTGAACACGGTCTTT
GCACAAGGTACGTTACTGACTGTGGCTTACTATGTGGGATTACTGTATTCTGCCGAGGCTGTCCAAGTCAAACCTGAAGCTGACACCAACTCTTCTAGAA
ACTCTTGCAAAATGGATTGGTGACTACCTGACCCAATCCGCTGGTGTGACAGTGGTATTCGAGTCCGCCATCGTGCCCAAATGGAAGGATGGTGTGATCA
CTTTCCGAAATGTCTTCATTTCACGCAGACCGGGACAGAGCAAGTCTTCTGTCAAGAAAGGCTCATCGACAAGTGCTGCTGCTGTAGCTGCAGCTAGGCA
AACTCAGCCGTCAGAAGAGGATGACGGTAATTACACGCAGTTCGACGTTACTATCAACACAGTAAACGTCACCCTATCGTTTTATAAGTGGTGGAACGGC
ACAGGACTTCTGAAGGACGTAGAGGTCAAAGGAGTCAGAGGGGTATTGGATCGGACATCGGTCCGCTGGTCAGACGGGCCGCATGATCCCTTTTCATATC
GGCACGTTCACCAACCTGGCGACTTTGAGATCGAGCACTTCAAGCTTGAAGATTTGCTACTCACCGTGCACCAGCCTGGCGGGTTCCGCCCTTTCCCAGT
CAGCATATATTCCTGCGAGCTGCCTCAGCTCAGGAAACAGTGGTTGTATTACGACTTTCTCAACGCGAACCATTGCTCAGGTTCCTTTGATGGGTCGCTA
TTCACAATTCATCCTCGCCAAATACATGGAGTGCCCGCTGGCGAGGTAGGCGCATCTGCAGATCATCTTGGCGAGGCTGGTGCTTGGAAGAAGTTCAGCA
GAATACGTATAGATGGATTGAAGATTGATCATCTCAACAGGGGCGTCGAGGGTCCCTTTGGGTGGATATACGAGGGCAACGTGGATATGGTGGCGGATCT
CATGTTTCCAGCAGACGAAGATGACTCCCTGGGCAAGGTCATGTCGGACTTTTACGACAAAATGGAGGATGCAGTCACAAAGAACAGGTATCTTCGGATA
CTGGACAAGAACCACAGGGGAGAGCTTGGCGAACGATTAAGCGAAAGATTTTCAAGGCCTGCTACAGTACCTATGGTGGTGCTCGATGAATCCAAGGGCC
ATGTCTCCGATTACACCACGGCCGATGCCGACTTTGGCCCCTCATCGCCCTCATCACGAACCGAAGAACCTCGAACGCCTGAAGCTGTCGATGAGGAGGA
GCCGCCGCGCTACCTGGTGATGGATCTTCGCATCCACCTGAACGATGTTCGCGCAGCCGTTCCGCTCTTCACTCACGACATATCATACATCTCGCAGCCC
CTGGTGCGGCCCATCGTGGCCTACATCAACGCCAAGCGCACCTACATTCCTGTCACGTGCCGCATAGTCAAGCGCACCTCAGACTTCAATGGATCCTGGA
CCCTCTACGACAGCGGTTTGATGGATGACATGAGTGCCGAGGTGTACGACGCGTTTGCTCGTAACGTTGAGGACCAGCACTCGAGGGTCAGGAGACTGAA
AAAGGTCGGCTTCTGGACGCTGAGTATGGTTGTCCATGCGCTCCTCGCTGGCGTCGCGGGCGATTTAATATAAAAAGAAAAAGGGAACGAACAGGCCAGG
ACCGGGTTCCGCGCTGTGTGGGGGTAAAACAGAACCAACACAACCCCCTTCTCAGTGACTTTCGTCTTCCTTTTGGGGACTTTTTTTCATGTATAATAAC
ACATATATCTCTGGATTGTCACATATTTAGGTAGGCTGGGTAACAAAGGGCATGGTCAGCGCGTGTAGAATTGTTTTTTATTATAGTTGCGGCTTTTGGT
CTGGTGTACAAAGAAAATTCTTAAATGTTTACTGAATGTGACCTACCCTTCGAGTTATTGGCCATGGAAGCACACAGATATTCACGAATCACGAATCCAG
CCTGTTCCGCATGACTTGATGTAGCTTGACCAGTTCATTTCTATTAATCTTGATAACGGGCGACAACTCGCCCAATGTCCCGCTAAATGCCTGACAAATA
AAAATCAGAAACGAAAAATTGCAATCTTGTACCCCTGGCTGATCTAGACACAAAAAAACACGACGACGACGGCTTCTACGCATGCGGAAGCCGTCCTCGT
ATTTCTCTTCTCCCTTGGCGCACTCGCAACCATGGTTAACCTCTTTCCGCATTTCATCGAGGCTTATAGTCTCTTTTGGCACAAAACACCATTTCGCCCT
TGAAGACAATCCCTTTCCGATTATCCCATCCAACCTCATATGCACATTAACAAAGACTCTCCCTTTCCCTTCCCCGGAAACGAGTCGAGTCGTCGCCATC
TTGCATCACAGCGCTGATGGCAAGAACAAGATAGTCCCCCCAAGCGAGGACTGGTTTTCCTCCCCCTACAGTTGCCCTCTGGAGTCTTGACCCCGCGCCA
GTGGCGCGTGGGTAGGACACATCCCGCGACTGATGATAAGTCTGTTTTGGGTGTTTGCAGGCCGGCTCCAGCGCCGATCTATGGTTGGATTCCCCAAGAC
GCAGTCTTTCTTTTCGCAGGGGTTTATTGGCAGCAACGAAGCGAGAGGGGGAATATTTGATATTGAAAGGCTGTGAGGCGCCTTTCACATAAAGTCGTCG
CTACAAAACAAAGTTAGCATCTTCTTCTTGGATCTCTGTTCCGTCTAGTCCCAAAGTTAAAAGAAAGTGCAACTTAC
TCTCCGAAAGTATCCTCATACGA
GTTGGTGTCAGTCACGCCAGCCCTGTTAGCGACCAGCGAGGTCTTTGTCTTGGCGGCCTTGGTCTTCTTGGTTCCGGCGGCGGCCTTCTCCTGCTTCATC
TTTTCGTTGCTGAGGGCCGTGAGCTTGCTCGAGATCTTCTTGATGTTCTCCGAGGGCATGTCGGCGCACAGCTGCCTGACAAACTCCTCCATAAAGTTGT
TGTAGTGCGGCTTCCTGCCAGAGCTGGCCGTGATGAGCGGGATCAGGGCCTGGCGCATGTCCTCAAACTGCGTCTTGGTCTTGGGGTTGAAGATGGGCAT
GTCGGACAGCTCAACCGTCTTGGAAGGGTCCGACGGGTCGATGCTGACGCTGGTGCTGGCGGCCTTGACCTTGCGGCCCGCGGGCACACCAATGTCACCA
AACAGGTCCTCGGCGTGGGCGAGATCGGCCTCCTTCTCGGTGCGACGGAGGCGCTCGCGGCGCTGCGACTCGGTCTCGTCGTCACTCTCGTCCGACTCCT
CGGCCTCCTTGCGACGCTGCTTGTGCTCGTTGATACGGGCGGCCTTGGTCTTCTTGTTGGCCTTGGCTTCGGCTTCGGCCTTGGCCTTGGCCTCTGCGGC
CTTCTTTGCCTTTTCGCGCTCTACCTCCGAGTCTTCGGCGGCATCCCACGAGTCGAGGAC
CTGGAGAGGGTGTGGGGGGTTAGTATTGGGGGATTTCCGA
GCTTGGCGAATCAGATGCAGAGCAACATGGCGGCGACGTCACATAC
ATCGCTGTCGTTGGCCTCCTCGTCATCGAACTTGCGGCGGGGGACTGAGACGGC
AACCGCGGGGGAGGACTCGTCGGAGCTGCCGGAGGAGGACTCCTCATCTT
CTGATGCGGCGGATGAACACTCGTTAGCAGCGTACAAGATGCGCAAAATG
AAACAGAGGCGCCATGAGGGGTTGTGCGCATTGCGCGTGTGGTGTTGCTGGCATGAGACAGTCAACTACCTAGTGACGATGGACTTAC
CCCACTTCTTTG
TTGGCAT
TTTGATGATGTTGATTTGTGAAATATGTTTCGAGGCTGATAACTGATCGAGATCGGATCTTGACGGGCTGTTGCGCCGCAATAAAATAAAAGC
GAAACGAGGTTGTAAAGGCAAGAGGGGCTTGAAGAGATGGTGTGAAAGGAAATGTGATTTGGGGTTGAAAAATAGCGCGTAAACAGCAAACATAAATCAG
GACACGAATGCAGGCCCAAAGGCTGTCCACAAACCTAAGTCAAGTCTTTTGTGCGTCAACTGCCCTGGCCCCAGCACTTTCAAATCCGTTCCGGCAGCGC
GACACTTTTTTTTTTTTTTACTATTATTATTCTACCCGTTTCTTCTCTCGTCGTCAGCAAAATTTACCCCTCCATGGGCAAATCACACGCCAAAATAGAA
ATTGCAGGGGGTGATCCCACAACCTGGGCGGGCCACATGCCAATGCTCCATCGATGCCCAAATATGCGTCATAGTACCGTTGACTTGCACTGAAGCGAGC
CTCCGGTCTATTCCGCTGCTGCAAGTGGTGGATTCCTGACTTTCTTTGTCAATGTAGAATGTCACTCAAATGACCATAAAACACCTCGCCAACCAATCAT
GATAGTCTTTCCGTTTTCAGATATTCCACCGATCCTTTCGGCGCTCTCTGCCATCTTAAACCCTCTGCACCTCTTAATTTCCTTGGTTTGCCCAATGTCA
GCTTGCTGCGTGCATGATCAACGTCGTTACAGTACTTTGCAGAGCCAAGCCTTAAATGAGCAAGAAGACGGCCGGGCTGTCGCTTCAAATATTGCAATGT
GCATACTCGCAAAAGTTGCAATTTTAGGGACACGTTTTCTACGAGCGCCTTGACAAGAACCAAGTATCATCTTCCAAAGTTGAGAATTTGCTTTGAAGCC
AACCCAGAGAAGGTCGATTCTATTGCAAATCAACCGGTCCAATCAATATAGTACTAACAATGTAAATTTATTTCGACCTGCATACCTACTTGGATACGTC
AACCACACACCTAGGTAGGTATGCAGGCATTTGTGTGAACTAAGCTGCTTGTGCATACCGGCCCCAGACCTACGGTTACGGAAGCGCTAACGACTATAAC
CGTCTTTGACCTCAAACCGGATTGAACACGGAAATTTCCGAATTACAAACAAGCAAAGTAGATATCCGGGCCATCTAAGCGGTTCAAACCACGAAGAAGT
CGTCGGTTTTTGTTATTTGTCTCTCATACCCCGAGATAAAGCCAAAAGAGGTGACTGGAGGTTGAACAGGCCCACTTGATCGTGTCAGGACTGAAGGTAC
CTATGTATATCCGCTGAGAAAGTCTGGGTATAACCAGGCAGAGATTTTTTTTTTCTCATTGTAGAAGTTTCTGCGAGGTTGCCTGTGATTGACACAAGGC
GTCGGCAAAGCAATCCAGCATGGCCATGTTGTGGATACGAGCAGCATCAGCCAAGCTTCCTTCCTCACTACATAACCTATGTTGGTTTACTTGGATGTCA
TCTTCGCAACCAAAATGTCGGGCAACTTTCAAATTTTTAAATCCTTGATTATTGCCTGCGGCGCGATTCGGGGTTTGTTCTGTATTTACTTCAGCAAACT
GAGTCACTCATTGCGGCATGCGCTAATATTCACTTCGGCGAATTCAGCCCTACAAGTGGGAAATACGGAGTAGCCCATCCATTCACCAACAGGGTGGACG
AAAATCATGCGGGACGGGCAGAGCGGCTCTGCTCAGACCAAAATTTGACCATCTACCGGTAGGCGACGTTGTTGCGATGGGCCTGCAAATGACTGCTGTG
CCACCTTATAATCTGACCCGACAAATCCCGAGCCCAATCACCGTCCATCGCCTAGCTTCCTACAACCCCCATTGATTATACTCAGCTGACCTTGCCTTAA
TACTCCTGCAAGCCTAGGATCAGGACTCAGCACTCCGTGTAGCCTGGGCTTTCGGGCTTTGCGCCTAAAGTTTTGTCTCTTGTCTCCCCGGTATTGCTAG
CATGTATACTTAGGATTGGTGCCTCCGTTGAATTTTCGTTTTGCAATGGCCGACCTCGTAACTAGGACCCGGTATCAATTCGTAAGGAAGCGCTGGGCAT
GATTGTTTGACGTCTTCGTTCCACGACGCATCCCACTGCATGGTGCTTACACCCCCAATATGGAATCGACCAATTGATATAAATGCAACGAAGACCCGTA
GCTGACGGATGACTGCTTTGCTTATCCTGAGGCACATGCCCTATATATCAAGCTCACCCACTTACATACTACCCGCATACTCACCTTTCAATCTCACCCT
ACTACTTCGTTTATCAAACGAACACTGAACGTACCGTCTTGATGCTTGTTCATCAGGTCAACACGAAGCTTTGCTCAGCAAAGCAGTTCACACACCTTGC
CAAAGTGGTGACACCTGCCCTGTCCTACCAGGCTTCTTCTGTGTACTCGGCAAACCTCCCTCGCCTAGCCGCTTCACCTCGCCTCTTCTCCACCACGAGC
TCCGCGCAGCTCCGAGACTTCTTCCCAGTCAAAGAGACAGAACATATTCGCCAGACGCCGCCAACATGGCCGCACCACGGCCTGACGGAGAAGGAGATGG
TGGATGTCGTCCCCGGCCACCGAAAGCCTAGGACTCTGGGCGATAAGTTTGCCTGGAGTCTGGTCCGGATTTCTCGGTAAGAGCTAGATTTATAGTTTCT
TATATGATTTAATGGCAACGCCAGAAAACAGAAAAACTGATAGTCGGTCTCTTCTGCATAGCTGGGGCATGGACAAAGTCTCAGGCCTCTCGTCGGAGCA
GCAGCAAATCAACAAGGGCAGTCCGACAACGTCAATCGTGGCCGCCAAGCCCTTGACCGAAGCACAATGGCTCAGCCGTTTCATCTTCCTCGAGTCCATC
GCGGCCGTGCCTGGCATGGTGGCCGGCATGCTGAGACACCTCCACTCGCTCCGGCGTCTGAAGCGCGACAACGGCTGGATCGAGACGCTGCTCGAGGAGG
CGTACAACGAGCGCATGCACCTCCTGACCTTCCTCAAGATGTGCGAGCCGGGCTGGCTCATGAAGATACTCATCATCGGCGCGCAGGGCGTCTACTTCAA
CGCCATGTTTGTCGCATACCTCATCAGCCCCAAGATTTGCCACCGCTTCGTCGGGTACCTTGAGGAGGAAGCCGTGCACACGTACACCAGGAGCATAGAA
GAGCTGGAGAGAGGAGACCTGCCCAAGTGGTCCGATCCGAAGTTCCAGGTGCCAGAAATTGCCGTATCATACTGGGGCATGCCAGAGGGCCACAGGACGA
TGCGAGACCTGTTGTTGTATATCCGAGCCGACGAGGTGAGTTTTTCCCGGCTGTTTTTTGAGCTCCAAAAGTATCCACCAAGTATAAATCAGCATGCTGA
CTAGATCGATTCTCCTAGGCGAACCATCGTGGTGTCCATCACACCCTCGGCAACCTGAACCAAGTTGAGGACCCTAATCCGTTCGTCAGCGACTACAAAG
GTGACAAGCCGCGGCCTGTTGCAGCGTCACGACCAGAAGGTTTTGAGCGGGAGGAGGTTATTGGCAAGGAGGTTATTGGCAAGGAGGTTATCGAAAAGGA
TGTTATAGGAAAGGAGGTTCTTGGAAAGCAGGTTTCAGTTTGAGGAATCTGCCACTACGCAAGACTGACACAAAGAGAAGAGAGAAGAAAGAAACATTTT
GTTGTTTTGGCACAACAGATGACATCCAAAAGTTATCTGTCTGCCTGCGTTTAGTTGTATACCCGAGTCTAGCTCTCCCACGTTTTGTAACATAGACCTT
TTGTTTGCTTGCCTCTTTGCACGGAAGACTCGCTGATGTTAGCTTTTGTCAGGCAATGGCATATCACATGAGCTGTAATAGTCATGAGGAAAGCAAAGCC
ACATGGGGAACAACCCCGAGCATGTTTGCTCGGAACGCAACCGTTCGGCTAACTAGGTACATTGTGTGTTGGAATGAGCTTGCCGCACTCCCCCTCAACC
GGCCCCTTCAACCGGGGTTCAACTTCGCACTAAAGGGGTGGGTGTGAGTTGGGTTGGAAGGAATGCAAAGTAAACCAATCCAGGCAAACGAGGAATAAGG
TCCTAGGAACATTAAGGTTCACGGCAGCCCTATGACTGCCGACCTCTACCAATCTGCAGGTGCTCGGTCGTCGGGCTACAGTGCATGGATGTCTTCGCAC
CCCGTCAGCTTGCGATCCGGGTCGGCGGCGGCATTAGAGCACGGCCCGCGAGTAGCACAGCCTCGAAGCAACGCCTCCCGTTCGATCCAACCTAGCCTGT
CTGTAGCGTGCAATTACTTTTCAATTGGACGAAAACCTTCAGCAAGCCTCTTGTGTTTACCGGTAGCAGCCGGTGCCGTAGATAGTTTGTACCACGTACA
AAACGGTGTGTACCTGGCTTCATTGGCGAGTTTTCGGGACCGTTGCTACAAAAGAAGGGCTCGGTCGATCAATAGTTTTAACTGGAGCCAAGCTTGTTAA
TCTATTTCCGTCACATAATCCCGGGTTTGATTGGATGAAATCCGTCAAAACCATGGATGATGTGAGACGATGGGTGAGATATGGATCGATGAGGGGTTAA
TGCTGTGCAAGGGCGACGGCTGTTGAACGAACCGAAAGGAGCAAATCAAAAGTTTGTGCAAAATATCGGATCGCTTGCTTCTGCCTGGAGCTCCTCGCCG
GTTTGTTAAACTCTACCGTGTGATCGGTGATGGCTTTTGTAATAGTAAGAAAAGGAAAACCTTGTCTGGTCCAGTAAAAAGATCCGGCGCGTTGAATCCA
AGGCACCTTTGGTACGGAATTTCGTATCGTCTGATGGACTTGGTGGGGTTCCCAAGCAACCAGCGTGGAGGGACCTTGCTTGCGGAGGGTAGGTACCCAC
CTCGGTAACTGCCAAACTTTGAGCGCAAATGAGCTATTCGACGCGAGGGATACACAGTGCATAAACCCCTTGTCGCATTTGGCGCAAACTGTTCTGCAAT
CATCCACCACTCTGTTCATGTACCAGTAGGTAAGGTAGTTTCAAAGATGGCCAAGCGCAGCAAAAAGAGTAGACAAACAAGTTAATCCAGTCCAAGTGTC
ATCGGTTCAAGTAAAATTCAGCGAGGTCGGATGATTTTACCCATTCTTGCTGCCTTTATTGTAAGGACTGAGTAGGTTCTCCGTATCAATTTCATGTGAT
ATCCAATGTTACCCTGGCACGTATCGGCCAACAATCTACCTTCGGTAGTGCATACTCATATGTACTGTACAGTATAAGTGTTCATCGAATGTTGTGGGCT
TGGACATCGTCAGAAATTAGATCTTGTACGTGGTACCGTACGATACGTTGACTAAAACAAGGAGAAATTCATAACTACCACGCAGATTATTACCATGGAA
TTTTTCGAGACGTCTCGGTTCAACCGCGAAATCAATGATTGATTTATTCATGCAATCGTCCGCACCCCTCTTGTTCCTGACAGCGAACCATCATCGCCAG
CACTGCCTCCATGTCATCCTAGGTGTTATCACGACACGAGCCGTCGTCTGGTCCCTGACTTGGTCTGGTTTCGACGTATATGTTTGACAAGCTGTGTAGT
AGCGAGAACTACATGGCTCACGAGTTGGAATCAGGCACGAGAATATGGTAACCGTAATTTCATGACGCCAGGATGTTTGTGCCAGTTGAGAGGGATCAAA
ATATCTACCTACCTTAGGTACCCAGGAGCTAGTTATTCAAGGACCTGACCCAGCAAAAACACAATTTCCTGAAACCGGCTTTTATAAAATAGAAATTTAC
TGACACTGCTGTTGTCACGTTTCGGGTCAAGGCAAACAAGCAACAGCCAAGGAATGAGATTGGTTATACATACACTTCGGCGAGATGGAACAAAAGAAAT
GACGGTGTACACATACCTACCTTAGAGGCCATACGGTGTAGGCCAATCTCACACATTCAACGCAGGACACACAAGTTTGCTAGTTGCATTACCAAAAATA
ACTGCTCCTGCCTAGTTCGATCGTGTAGCCTCGACCAACATTAGCCTGACCGCCGCCGCCGTTGTGAATTACCTACCGGTCTACCTACCTAAGTATCCAA
GCAAATCACTGGCAACTGTTTTAAAAGTCCGTCATCCAAGTCGTCGGACACTCTTACGTCTATGTTTGTATTTGGTAGATCCGAAAAGGCACGCGTCCAC
TTTTGTGCTGCTCGTCATCAATTGGAAGTTACCTGGCGTGCTGCCTCAATTTCCAATTTCGTAGATCCCCACCCACAGGCCGTGTTTCGACCAATCGTGC
CGTACTGCATACTGCGCCGGTGGTCGGTACCTGCCTCCACTGCCTACAAGTACATACCTGCACCGGCCAACGGCTTGGGCAGGTCGCCCCAACCCACTCA
GCAACTTTAAGGTTCCTCCTCCATTTTTGCCCGCGGATCTTAATCCACCACCACAACCCCTCGAATCGGGCGCTTGTCGCAACGACCTGTCGAGATAACA
TCGTATCGCAGCGTATCTCATGGCATCCATCTAGTTCTAATTCTAGTTCTAGTTCAAATCGCGTTGACAAACAATCATCATACTTTGTTTTCCCACTATC
CCTGCTCGAGGTCGACCACGGGATTTGCATCTCTATCCCAAACACGGCTCCTCCATTCCCTTCGTCGCGGGCACTTCCCTGCCAATCCCGGGACCGACTT
GATTGGTTCTGCCCTGCTGTCAGCTCGCCAAAATACACAGCCCCCCACATCCGCTAGGCACTGCCACCACACCACGAAGGCTGACTCGTTTTCTGCCTCG
TCTTGCTCGAGTCTTGCCTTGCCTGGTCCATTCTCATCTGCCCGCGTTTTGCGTCTGGTGCAGGTTAGGTTCCAACCCACAAGAATAGGCACAAGCTCTT
TGCTACGGTGTGTGCGCGCGCGACTTCTCCGTCATCACCTCTCTGGTGAGACCGCTCTGCACCGCGCCGAAACAACCTTAACAGTACGCCCACCATTCCA
ACAGCTACGGTGCGCAGCACAGCACGGCACTGCACCAAATCGAATCGAATCGCACCACCCGCTGCCACCGCATAGCTTTCGCCATGGATCAGTTGCAGCA
CCACCAGGGTCCCGGGCGCGCTCGTTCGCCATCAGCCGCCAGTACTGGCGCTGCCTTCCAGCAACAACACCAGGAACACCCGCAGCCTCATATAAGAAGC
CACTCGCCGGCGCCTGCGCCTCAGTCATTCTCGAGCCCCCAACATAATGGTCTCGGGCTTGGTATCGAACATTCGCAGTCCTTCTCAGGCTTCAACCCCA
ATCCTAGCGACTTCCTCAACCCCCAACCGTCTCAAACGTTCCCAAGCCAGGGCCAGCTAGACCCCTCATCCTTCGACGCGACTCAGCCGTTCGACAGCAA
CAACCAGGCCCAGCCAGGATATTCACAAGAGTTCTTGAATAATAACAACAACTTTGGCGGCTCTGACTTTTCTCTTTTCCCTCCTGCAACTACAGAACAG
CTCAGCACGCCCTTATTTGTAACGGGAGACAATCAACAGCAGCCGCCCCAACTCAGCACCCCAGACCTGAACATGAGCACGTCCCAAGTCCACCATAGCC
CGACACCTCCCCACCATCTGAAGCCGGAACCGCATCAACCCGGCTCCGCCCACCAGTCCCCGTCATTCAACCAGCACCAGTTCTCGTCGCCGCCTGCCCG
TCACTCGCGCCATGCCTCGTTAGGTCCTGAGGCGGCCCTGCTACCAGGCCAGGTCGACTGGAGCGGTACACAGTTTCAGGGACACAGGCGCACCCCTTCA
GAGTATTCGGATGTGTCATCCGTTGCTCCATCGCCCAACCTTGTCAGCCATGATAGCTTTGATCATATCGAGCATAGCCCGATGCAACGGCCCGTCGATA
CGGCCGGCCTATACCAGGAGCTCCACGGCCTGGGGAACTTTAGTCTCGCCGATCCCCCGCCTCCTCATGCTCACAGCCCTGATCTAAGAGGCAGGAGTCC
GTCGCACAGCCCAGCAATCTCCCCGAGGATCCCGCCACAGCAGCTGCCCGACATGAACCAACCCAACAGTAGCTTCATGCTTCAAGGCCAGAATGGCTTT
GGCACCCCCCAGATTGCCCTGCAGTCCTCCGAGGCCTTTCCTCAACTGCCACAGCATGGCTTGGCGCAGATGGCGGCGCCGACAATCAACATCGATTATG
CGCCGACGAACCTGAGAAACTTTGAGGGCAGACCGATGATGGACTCTGATGCGCTGACCCCGCCGGATAGAGGTTCGTGGACGTCCTTGCTTGTTTTGCT
GTGTTGGAACGGCCAAGCATCCACTTCGCGACGATAATGAATCAATGCTAACACAAAAGTTTATACTTTAGGACGCGTAAGAAACCGCCCACGTGCTGTC
ACGGATCCTTATGCCAATGGAAGTACCGCGCCTCTTCCGCGACCTCTTGGTACAGCCAGCTTGTCTCCCAGCCCAGGGCTGTCATCAAGAGACTCATCGC
GCTCCTTGTCACCATTGGATCGCTCGATACCACCAAATAAGAGGCGTCAGTCCACCTCTGCGGTGCCCAATAATGTCATGGCCCTACGTCTTGCAGACCC
TGAATTCGCAGCTCAGGGCAGTGGAGACGGGACTGCGGCAGGCGGCGGGCCGAAGCGGGTCCAGAAACACCCCGCAACATTTCAATGCTCATTATGTCCG
AAGCGGTTCACTAGAGCCTACAATCTTAGGAGCCATCTGCGCACCCACACTGATGAGAGGCCGTTCGTGTGTACGGTGTGCGGCAAGGCGTTTGCTCGGC
AGCATGATCGGAAAAGGCACGAAGGCCTGCATTCTGGAGAGAAGAAGTTTGTCTGCAAGGGTGACCTTAAAGCTGGCGGGCAATGGGGTTGTGGCAGGAG
GTTTGCCCGTGCCGATGCGCTGGGTAGACATTTCAGGTCTGAGGCAGGCCGTATTTGCATCAAACCTTTACTAGATGAGGAGATCATGGAACGGCAAAGA
ATCTGGCAGGAGCAGCGCATGCAGGCGGCGCAACACCAGCAGCACATGATGATGCCGCCTCCAGGCATAGACCCCAACACCGGATATCCCGTGGACGCTG
CTGGTAACTACTCATTACCGGCCGCGATTTTGGCGCAGTATCCTGCCCTTGCCCAGATGAACTGGGGCACGGCCGGCGGCGGCATCGATGGCGGATCAGG
CATTGAGGATGATATTTCGGGCCGCAGTAGCTTTGATGCCAGCGATTACGACGATGCCGACGATGGCGGATATGTGTCTGGGCCCGGGACCGGATTTGGT
CAGGGCGGCATGAACGAAGGGTTTGGTGAAATGGGGTACGCAAGTGACTACGGTGGTCGCTAGTCTTGATGACAATTTGATACGAGATGCCTGAGTTGCC
CAGACATTTGATGAACGGCGGGATTGTTCCATTTTATGACTACTACCTGGATGGCCACTTTACGTTTGGATAACGATGTTTGATGTTTTAGCATTGTGGA
GCTCTCAGCCATTCCTGGGTGCGAATACTCGGCGAGGGCTTGAGACCCCCCCTGTGATGGTTCCACGGATCTACGTTTTCTTATTTCTTATTCCTTACTC
TTTGTTAAGCTTTGTTTTGGGTGGTTTGCCCTAGCCGAGCATAACGACCTTGATGGTTTGTTTATGTACTTTTGCGGGGTTCGGATTCCATTTGCCTCTT
ATACCTTTTCTCGCGGTTGTCCTGTTGTTATTTCTTTTTATATAGACGGCATTTCTTGGATGCCACAGAGATACCAATCCTGTTCAAGCTATTGCTGTAT
GCTTTACATATACCACCAGGCTGTGAGATAATGTGCTTTCTTGGTTTTCCTCGGAAAGAGGGGTTCGACCAAAGTCAACTTGCCATCCGATCCTGATGAT
Copyright 2006 Fungal Plant Pathology Lab. & FBL
E-mail : yonglee@snu.ac.kr
Magnaporthe oryzae ATMT Database